KEGG   Heterocephalus glaber (naked mole rat): 101703691
Entry
101703691         CDS       T02812                                 

Gene name
Pik3r1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04070  Phosphatidylinositol signaling system
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04960  Aldosterone-regulated sodium reabsorption
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05100  Bacterial invasion of epithelial cells
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05146  Amoebiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101703691 (Pik3r1)
   04014 Ras signaling pathway
    101703691 (Pik3r1)
   04015 Rap1 signaling pathway
    101703691 (Pik3r1)
   04370 VEGF signaling pathway
    101703691 (Pik3r1)
   04630 JAK-STAT signaling pathway
    101703691 (Pik3r1)
   04668 TNF signaling pathway
    101703691 (Pik3r1)
   04066 HIF-1 signaling pathway
    101703691 (Pik3r1)
   04068 FoxO signaling pathway
    101703691 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    101703691 (Pik3r1)
   04072 Phospholipase D signaling pathway
    101703691 (Pik3r1)
   04071 Sphingolipid signaling pathway
    101703691 (Pik3r1)
   04024 cAMP signaling pathway
    101703691 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    101703691 (Pik3r1)
   04152 AMPK signaling pathway
    101703691 (Pik3r1)
   04150 mTOR signaling pathway
    101703691 (Pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101703691 (Pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    101703691 (Pik3r1)
   04218 Cellular senescence
    101703691 (Pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101703691 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101703691 (Pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101703691 (Pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101703691 (Pik3r1)
   04613 Neutrophil extracellular trap formation
    101703691 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    101703691 (Pik3r1)
   04625 C-type lectin receptor signaling pathway
    101703691 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    101703691 (Pik3r1)
   04660 T cell receptor signaling pathway
    101703691 (Pik3r1)
   04662 B cell receptor signaling pathway
    101703691 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    101703691 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    101703691 (Pik3r1)
   04670 Leukocyte transendothelial migration
    101703691 (Pik3r1)
   04062 Chemokine signaling pathway
    101703691 (Pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101703691 (Pik3r1)
   04923 Regulation of lipolysis in adipocytes
    101703691 (Pik3r1)
   04929 GnRH secretion
    101703691 (Pik3r1)
   04915 Estrogen signaling pathway
    101703691 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    101703691 (Pik3r1)
   04917 Prolactin signaling pathway
    101703691 (Pik3r1)
   04926 Relaxin signaling pathway
    101703691 (Pik3r1)
   04935 Growth hormone synthesis, secretion and action
    101703691 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    101703691 (Pik3r1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101703691 (Pik3r1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101703691 (Pik3r1)
  09156 Nervous system
   04725 Cholinergic synapse
    101703691 (Pik3r1)
   04722 Neurotrophin signaling pathway
    101703691 (Pik3r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101703691 (Pik3r1)
  09158 Development and regeneration
   04360 Axon guidance
    101703691 (Pik3r1)
   04380 Osteoclast differentiation
    101703691 (Pik3r1)
  09149 Aging
   04211 Longevity regulating pathway
    101703691 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    101703691 (Pik3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101703691 (Pik3r1)
   05206 MicroRNAs in cancer
    101703691 (Pik3r1)
   05205 Proteoglycans in cancer
    101703691 (Pik3r1)
   05203 Viral carcinogenesis
    101703691 (Pik3r1)
   05230 Central carbon metabolism in cancer
    101703691 (Pik3r1)
   05231 Choline metabolism in cancer
    101703691 (Pik3r1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101703691 (Pik3r1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101703691 (Pik3r1)
   05212 Pancreatic cancer
    101703691 (Pik3r1)
   05225 Hepatocellular carcinoma
    101703691 (Pik3r1)
   05226 Gastric cancer
    101703691 (Pik3r1)
   05214 Glioma
    101703691 (Pik3r1)
   05221 Acute myeloid leukemia
    101703691 (Pik3r1)
   05220 Chronic myeloid leukemia
    101703691 (Pik3r1)
   05218 Melanoma
    101703691 (Pik3r1)
   05211 Renal cell carcinoma
    101703691 (Pik3r1)
   05215 Prostate cancer
    101703691 (Pik3r1)
   05213 Endometrial cancer
    101703691 (Pik3r1)
   05224 Breast cancer
    101703691 (Pik3r1)
   05222 Small cell lung cancer
    101703691 (Pik3r1)
   05223 Non-small cell lung cancer
    101703691 (Pik3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101703691 (Pik3r1)
   05017 Spinocerebellar ataxia
    101703691 (Pik3r1)
   05020 Prion disease
    101703691 (Pik3r1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101703691 (Pik3r1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101703691 (Pik3r1)
   04932 Non-alcoholic fatty liver disease
    101703691 (Pik3r1)
   04931 Insulin resistance
    101703691 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101703691 (Pik3r1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101703691 (Pik3r1)
   05100 Bacterial invasion of epithelial cells
    101703691 (Pik3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101703691 (Pik3r1)
   05170 Human immunodeficiency virus 1 infection
    101703691 (Pik3r1)
   05161 Hepatitis B
    101703691 (Pik3r1)
   05160 Hepatitis C
    101703691 (Pik3r1)
   05171 Coronavirus disease - COVID-19
    101703691 (Pik3r1)
   05164 Influenza A
    101703691 (Pik3r1)
   05162 Measles
    101703691 (Pik3r1)
   05168 Herpes simplex virus 1 infection
    101703691 (Pik3r1)
   05163 Human cytomegalovirus infection
    101703691 (Pik3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101703691 (Pik3r1)
   05169 Epstein-Barr virus infection
    101703691 (Pik3r1)
   05165 Human papillomavirus infection
    101703691 (Pik3r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101703691 (Pik3r1)
   05142 Chagas disease
    101703691 (Pik3r1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101703691 (Pik3r1)
   01524 Platinum drug resistance
    101703691 (Pik3r1)
   01522 Endocrine resistance
    101703691 (Pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101703691 (Pik3r1)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101703691 (Pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Lant_dehydr_C Mod_r PI_PP_I FANCI_S2 Bap31_Bap29_C
Other DBs
NCBI-GeneID: 101703691
NCBI-ProteinID: XP_004862895
UniProt: A0A0P6J6G9
LinkDB
Position
Un
AA seq 730 aa
MVTSANMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVAHGFSDGQEARPEEIG
WLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADIEQQALT
LPDLAEQFAPPDIAPPLLIRLVEAIEKKGLECATLYRTQSSSNSVELRQLLDCDVASMDL
EMVDVQVLADAFKRYLLDLPNPVIPVAVYSEMISLAQEVQSSEDYIQLLKKLIRSPNIPH
QYWLTLQYLLKHFFKLSQSSSKNLLSARVLAEIFSPMLFRFPAASSDSTENLIKVIEILI
STEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGT
FLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLA
QYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTS
QEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSR
ISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKL
NEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQ
GCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTL
AYPVYAQQRR
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggtaacatctgcaaacatgagtgctgagggctaccagtacagagcattgtatgattat
aaaaaggaaagagaggaagacatcgacctacacttgggagacatactaactgtgaacaaa
gggtccttggttgcacatggattcagtgatggacaggaagcccggccagaagaaattggc
tggttaaatggctataatgaaaccactggggagaggggggacttcccggggacttatgtg
gaatatattggaaggaaaaagatctcacctcccactccaaagcccaggccacctcgaccc
cttcctgttgcaccaggttcttcaaaaactgaagcagacattgagcaacaagctttgacc
cttccagatctggcagagcagtttgcacctcctgacattgccccacctctcctcatcagg
ctagtggaagccattgaaaagaaaggtctggaatgtgcgactctatacagaacacagagc
tccagcaattctgtagaattacgacagcttcttgattgtgatgttgcctccatggacttg
gaaatggtcgatgtacaagttttagcagatgcttttaaacgctatctcctggacttacca
aatcctgtcattccagtagccgtttacagtgaaatgatttctttagctcaagaagtacaa
agctccgaagactatatccaactgttgaagaagctcattaggtctcctaacatacctcat
cagtattggcttacgcttcagtatttgctaaaacatttcttcaaactctctcaatcttcc
agcaaaaatcttttgagcgcaagagtgcttgctgaaattttcagccctatgcttttcaga
tttccagcagccagctctgatagtactgaaaacctcataaaagttatagaaattttaatc
tcaactgaatggaatgaacgacagccagcaccagcactgcctccgaagccacccaaaccc
accacggtagccaacaacggtatgaataacaatatgtctttacaagatgcggaatggtac
tggggagatatctccagggaagaagtgaatgaaaaacttcgagatacagcagatggaacc
tttttggtacgagatgcatctactaaaatgcatggtgattatacgcttacactaaggaaa
ggagggaataacaaattaatcaagatatttcaccgagatggaaaatatggcttctcagac
ccattaaccttcaattctgtggttgaactaataaaccactaccggaatgaatctctagct
cagtacaatcccaaactggatgtgaagttactgtatccagtatccaaataccaacaggat
caagttgtcaaagaagataacattgaagctgtagggaaaaagttacatgaatataacact
caatttcaagaaaaaagtcgagaatatgatagattatatgaagaatatactcgtacttcc
caagaaatccaaatgaaaagaacagctattgaagcatttaatgaaaccataaaaatattt
gaagaacagtgccaaacccaggagcggtacagcaaagaatacatagaaaagtttaaacgt
gaaggcaatgagaaagagatacagaggattatgcataattatgataagttaaagtcacga
atcagtgaaattattgacagtagaagaagattggaggaagacttgaaaaagcaagcagct
gagtatcgagagattgacaaacgtatgaacagcattaaaccagacctcattcaactgaga
aagacgcgcgaccagtacttgatgtggttgactcaaaaaggtgttcggcaaaagaagttg
aacgagtggttgggcaacgaaaacactgaagaccaatattcactggtggaagacgatgaa
gatttgccccaccatgatgaaaagacatggaatgttggcagcagcaaccgcaacaaagct
gaaaacctgctgcgagggaagcgcgacggcacttttctcgtccgggagagcagtaagcaa
ggctgctatgcctgctctgtggtggtggacggtgaggtcaagcattgtgtcatcaacaaa
acagcaactggctatggctttgcagagccctataacttgtacagctccctgaaggaactg
gtgctacattatcaacacacctccctcgtgcagcacaacgactccctcaatgtcacacta
gcatacccggtatatgcacagcagaggcgatga

KEGG   Heterocephalus glaber (naked mole rat): 101711934
Entry
101711934         CDS       T02812                                 

Gene name
Pik3ca
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00562  Inositol phosphate metabolism
hgl01100  Metabolic pathways
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04070  Phosphatidylinositol signaling system
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04960  Aldosterone-regulated sodium reabsorption
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05100  Bacterial invasion of epithelial cells
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05146  Amoebiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101711934 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101711934 (Pik3ca)
   04014 Ras signaling pathway
    101711934 (Pik3ca)
   04015 Rap1 signaling pathway
    101711934 (Pik3ca)
   04370 VEGF signaling pathway
    101711934 (Pik3ca)
   04630 JAK-STAT signaling pathway
    101711934 (Pik3ca)
   04668 TNF signaling pathway
    101711934 (Pik3ca)
   04066 HIF-1 signaling pathway
    101711934 (Pik3ca)
   04068 FoxO signaling pathway
    101711934 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    101711934 (Pik3ca)
   04072 Phospholipase D signaling pathway
    101711934 (Pik3ca)
   04071 Sphingolipid signaling pathway
    101711934 (Pik3ca)
   04024 cAMP signaling pathway
    101711934 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    101711934 (Pik3ca)
   04152 AMPK signaling pathway
    101711934 (Pik3ca)
   04150 mTOR signaling pathway
    101711934 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101711934 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    101711934 (Pik3ca)
   04218 Cellular senescence
    101711934 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101711934 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    101711934 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101711934 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101711934 (Pik3ca)
   04613 Neutrophil extracellular trap formation
    101711934 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    101711934 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    101711934 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    101711934 (Pik3ca)
   04660 T cell receptor signaling pathway
    101711934 (Pik3ca)
   04662 B cell receptor signaling pathway
    101711934 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    101711934 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    101711934 (Pik3ca)
   04670 Leukocyte transendothelial migration
    101711934 (Pik3ca)
   04062 Chemokine signaling pathway
    101711934 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101711934 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    101711934 (Pik3ca)
   04929 GnRH secretion
    101711934 (Pik3ca)
   04915 Estrogen signaling pathway
    101711934 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    101711934 (Pik3ca)
   04917 Prolactin signaling pathway
    101711934 (Pik3ca)
   04926 Relaxin signaling pathway
    101711934 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    101711934 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    101711934 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101711934 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101711934 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    101711934 (Pik3ca)
   04722 Neurotrophin signaling pathway
    101711934 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101711934 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    101711934 (Pik3ca)
   04380 Osteoclast differentiation
    101711934 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    101711934 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    101711934 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101711934 (Pik3ca)
   05206 MicroRNAs in cancer
    101711934 (Pik3ca)
   05205 Proteoglycans in cancer
    101711934 (Pik3ca)
   05203 Viral carcinogenesis
    101711934 (Pik3ca)
   05230 Central carbon metabolism in cancer
    101711934 (Pik3ca)
   05231 Choline metabolism in cancer
    101711934 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101711934 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101711934 (Pik3ca)
   05212 Pancreatic cancer
    101711934 (Pik3ca)
   05225 Hepatocellular carcinoma
    101711934 (Pik3ca)
   05226 Gastric cancer
    101711934 (Pik3ca)
   05214 Glioma
    101711934 (Pik3ca)
   05221 Acute myeloid leukemia
    101711934 (Pik3ca)
   05220 Chronic myeloid leukemia
    101711934 (Pik3ca)
   05218 Melanoma
    101711934 (Pik3ca)
   05211 Renal cell carcinoma
    101711934 (Pik3ca)
   05215 Prostate cancer
    101711934 (Pik3ca)
   05213 Endometrial cancer
    101711934 (Pik3ca)
   05224 Breast cancer
    101711934 (Pik3ca)
   05222 Small cell lung cancer
    101711934 (Pik3ca)
   05223 Non-small cell lung cancer
    101711934 (Pik3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101711934 (Pik3ca)
   05017 Spinocerebellar ataxia
    101711934 (Pik3ca)
   05020 Prion disease
    101711934 (Pik3ca)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101711934 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101711934 (Pik3ca)
   04932 Non-alcoholic fatty liver disease
    101711934 (Pik3ca)
   04931 Insulin resistance
    101711934 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101711934 (Pik3ca)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101711934 (Pik3ca)
   05135 Yersinia infection
    101711934 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    101711934 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101711934 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    101711934 (Pik3ca)
   05161 Hepatitis B
    101711934 (Pik3ca)
   05160 Hepatitis C
    101711934 (Pik3ca)
   05171 Coronavirus disease - COVID-19
    101711934 (Pik3ca)
   05164 Influenza A
    101711934 (Pik3ca)
   05162 Measles
    101711934 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    101711934 (Pik3ca)
   05163 Human cytomegalovirus infection
    101711934 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101711934 (Pik3ca)
   05169 Epstein-Barr virus infection
    101711934 (Pik3ca)
   05165 Human papillomavirus infection
    101711934 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101711934 (Pik3ca)
   05142 Chagas disease
    101711934 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101711934 (Pik3ca)
   01524 Platinum drug resistance
    101711934 (Pik3ca)
   01522 Endocrine resistance
    101711934 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101711934 (Pik3ca)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101711934 (Pik3ca)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101711934 (Pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC
Other DBs
NCBI-GeneID: 101711934
NCBI-ProteinID: XP_004834677
UniProt: A0A0P6JG58
LinkDB
Position
Un
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
CHGGEPLCDNVNTQRVPCSNPRWNEWLNYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttattaccaaatggaatgatcgtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaggaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggag
gaattttttgatgaaacaagacgactttgtgaccttcgcctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaggaaaagatcctcaatcgagaaattggttttgtt
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtgcaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatacaataaattagataaaggacaaataattgtggtgatttgggtaatagtttctcca
aataatgacaagcagaaatatactttgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaagaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtatgtggatgtgatgaatac
ttcctagaaaaatatcccctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactctcaactaccaatggac
tgttttacaatgccatcctattccagacgcatctctacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacttatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
tgccacggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cctaggtggaatgaatggctgaattatgatatgtacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggagcactgt
ccattggcctggggaaatataaacttgtttgattatacagacaccctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagacttgctaaaccctattggt
gttaccgggtcaaatccaaacaaagaaactccatgcctagagttggagtttgattggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgcaaattggtctgta
tcccgagaagcaggatttagttattcacatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgacaaagaacagctccgagcaatttgtacacgagaccctctg
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccctgaaattctacctaaattgcttctgtccgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcccccaatcaaacctgagcaggcaatggag
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcgatgcttggaa
aaatatttgacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacaatatttggataatctgcttgtgagatttttactcaagaaagcactaacaaat
caaaggattggacactttttcttttggcatttaaaatctgagatgcataataaaacagtt
agtcaaagattcggtctgcttttggaatcctattgtcgtgcctgtgggatgtatctgaag
cacctgaataggcaagttgaagctatggaaaagctcattaacttaactgacattctcaag
caggaaaagaaggatgagacacaaaaggtacagatgaagtttttagttgagcagatgagg
caaccagatttcatggatgctctacagggctttctatctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcttctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacgccaagatatgctaacgcttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgctgccttacggttgtctctca
attggtgactgcgtgggacttattgaggtggtgagaaattctcacactatcatgcagatt
cagtgcaaagggggcctgaaaggtgcactgcagttcaatagccacacactgcatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctctttacacgttca
tgtgctggatattgcgtggctaccttcattttgggaattggagaccgtcacaatagtaac
atcatggttaaagatgatggacaactatttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtcccatttgttttgacacaagatttc
ttaatagtgataagtaaaggggcccaagaatgtacaaagacgagagaatttgaaaggttt
caggagatgtgttacaaggcatatctagctattcggcagcatgccaatctcttcataaac
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tatattcgaaagaccctagccttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggaggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgcattgaactga

KEGG   Heterocephalus glaber (naked mole rat): 101712941
Entry
101712941         CDS       T02812                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00562  Inositol phosphate metabolism
hgl01100  Metabolic pathways
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04070  Phosphatidylinositol signaling system
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04960  Aldosterone-regulated sodium reabsorption
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05100  Bacterial invasion of epithelial cells
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05146  Amoebiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101712941 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101712941 (Pik3cd)
   04014 Ras signaling pathway
    101712941 (Pik3cd)
   04015 Rap1 signaling pathway
    101712941 (Pik3cd)
   04370 VEGF signaling pathway
    101712941 (Pik3cd)
   04630 JAK-STAT signaling pathway
    101712941 (Pik3cd)
   04668 TNF signaling pathway
    101712941 (Pik3cd)
   04066 HIF-1 signaling pathway
    101712941 (Pik3cd)
   04068 FoxO signaling pathway
    101712941 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    101712941 (Pik3cd)
   04072 Phospholipase D signaling pathway
    101712941 (Pik3cd)
   04071 Sphingolipid signaling pathway
    101712941 (Pik3cd)
   04024 cAMP signaling pathway
    101712941 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    101712941 (Pik3cd)
   04152 AMPK signaling pathway
    101712941 (Pik3cd)
   04150 mTOR signaling pathway
    101712941 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101712941 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    101712941 (Pik3cd)
   04218 Cellular senescence
    101712941 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101712941 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    101712941 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101712941 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101712941 (Pik3cd)
   04613 Neutrophil extracellular trap formation
    101712941 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    101712941 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    101712941 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    101712941 (Pik3cd)
   04660 T cell receptor signaling pathway
    101712941 (Pik3cd)
   04662 B cell receptor signaling pathway
    101712941 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    101712941 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    101712941 (Pik3cd)
   04670 Leukocyte transendothelial migration
    101712941 (Pik3cd)
   04062 Chemokine signaling pathway
    101712941 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101712941 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    101712941 (Pik3cd)
   04929 GnRH secretion
    101712941 (Pik3cd)
   04915 Estrogen signaling pathway
    101712941 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    101712941 (Pik3cd)
   04917 Prolactin signaling pathway
    101712941 (Pik3cd)
   04926 Relaxin signaling pathway
    101712941 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    101712941 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    101712941 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101712941 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101712941 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    101712941 (Pik3cd)
   04722 Neurotrophin signaling pathway
    101712941 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101712941 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    101712941 (Pik3cd)
   04380 Osteoclast differentiation
    101712941 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    101712941 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    101712941 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101712941 (Pik3cd)
   05206 MicroRNAs in cancer
    101712941 (Pik3cd)
   05205 Proteoglycans in cancer
    101712941 (Pik3cd)
   05203 Viral carcinogenesis
    101712941 (Pik3cd)
   05230 Central carbon metabolism in cancer
    101712941 (Pik3cd)
   05231 Choline metabolism in cancer
    101712941 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101712941 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101712941 (Pik3cd)
   05212 Pancreatic cancer
    101712941 (Pik3cd)
   05225 Hepatocellular carcinoma
    101712941 (Pik3cd)
   05226 Gastric cancer
    101712941 (Pik3cd)
   05214 Glioma
    101712941 (Pik3cd)
   05221 Acute myeloid leukemia
    101712941 (Pik3cd)
   05220 Chronic myeloid leukemia
    101712941 (Pik3cd)
   05218 Melanoma
    101712941 (Pik3cd)
   05211 Renal cell carcinoma
    101712941 (Pik3cd)
   05215 Prostate cancer
    101712941 (Pik3cd)
   05213 Endometrial cancer
    101712941 (Pik3cd)
   05224 Breast cancer
    101712941 (Pik3cd)
   05222 Small cell lung cancer
    101712941 (Pik3cd)
   05223 Non-small cell lung cancer
    101712941 (Pik3cd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101712941 (Pik3cd)
   05017 Spinocerebellar ataxia
    101712941 (Pik3cd)
   05020 Prion disease
    101712941 (Pik3cd)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101712941 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101712941 (Pik3cd)
   04932 Non-alcoholic fatty liver disease
    101712941 (Pik3cd)
   04931 Insulin resistance
    101712941 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101712941 (Pik3cd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101712941 (Pik3cd)
   05135 Yersinia infection
    101712941 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    101712941 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101712941 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    101712941 (Pik3cd)
   05161 Hepatitis B
    101712941 (Pik3cd)
   05160 Hepatitis C
    101712941 (Pik3cd)
   05171 Coronavirus disease - COVID-19
    101712941 (Pik3cd)
   05164 Influenza A
    101712941 (Pik3cd)
   05162 Measles
    101712941 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    101712941 (Pik3cd)
   05163 Human cytomegalovirus infection
    101712941 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101712941 (Pik3cd)
   05169 Epstein-Barr virus infection
    101712941 (Pik3cd)
   05165 Human papillomavirus infection
    101712941 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101712941 (Pik3cd)
   05142 Chagas disease
    101712941 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101712941 (Pik3cd)
   01524 Platinum drug resistance
    101712941 (Pik3cd)
   01522 Endocrine resistance
    101712941 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101712941 (Pik3cd)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101712941 (Pik3cd)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101712941 (Pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 101712941
NCBI-ProteinID: XP_004863704
UniProt: A0A0P6J9T8
LinkDB
Position
Un
AA seq 1045 aa
MPPGVDCPMEFWTKEENQNVVVDFLLPTGIYLNFPVSLNANLRTIKQVLWYRAQYEPLFH
MLSGPEAYVFTCVNQTAEQQELEDEQRRLCDIRPFLPVLRVVAREGDRVKKLINSQISLL
IGKGLHEFDSLGDPEVNDFRAKMRQFCEEAAARRQQLGWEDWLQYSFPLQLEPSAGSWGP
STLRLPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEDYV
LQVNGRLEYLYGSYPLCQFQYVCSCLHSGLTPHLTMVHSSSILAMRDGQGNPDPQVQKPH
PKPPPVPTKKPSSVSLWSLEQLFCIELIQGSKVNADERMKLVVQAGLFHGHEMLCKTVSS
SEVSVCSEPVWKQRLEFDISICDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANIMLFDYRDQLKTGERRLYMWPSVPDEKGELLNPAGSVHGNPNTESAAALVIFLPEVAP
HPVYYPALEKILELGRHGEQRGQGTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQ
EHFPDALARLLLVTKWHKHEDVAQMLYLLCSWPELPILSALELLDFSFPDCHVGSFAIRS
LRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPS
VALRFGLIMEAYCRGSTHHMKVLMKQGEALNKLKALNDFVKVSSQKTTKPQTKELMHLCM
RQETYLEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSKEAGTTGSVGIIFK
NGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQL
NKSNMAATAAFNKDALLNWLKSKNPGEALERAIEEFTLSCAGYCVATYVLGIGDRHSDNI
MIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGY
CERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKF
NEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgccccccggggtcgactgccccatggagttctggaccaaggaggaaaatcagaacgtg
gtggtggacttcctgctccccacggggatctacctcaacttccctgtgtccctcaatgcc
aacctcaggaccatcaagcaggtgctgtggtatcgggcacagtatgagccgctcttccac
atgctcagcggtcctgaggcctacgtgttcacctgcgtcaaccagacagcagagcagcag
gagctggaggacgagcagcggcggctgtgcgacattcggcccttcctgccggtgctgcgc
gtggtggcccgggagggcgatcgagtcaagaagctcatcaactcccagatcagcctcctc
atcggcaaaggcctccacgagttcgactccctgggtgacccagaagtgaacgacttccgt
gccaagatgcgccagttctgcgaggaggcggctgcaaggcgccagcagctgggctgggag
gactggctgcagtatagcttccccctgcagctcgagccctcggccgggagctgggggccc
agcaccctgaggctccccaaccgggccctgctggtcaacgtcaaattcgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacatgccgctggcgctcatggcctgcgcc
ctgcgcaagaaggccacagtcttccggcagccgctggtggagcagccggaggactacgtg
ctgcaggtgaacgggcggctcgagtacctatacggcagctacccgctgtgccagttccag
tatgtctgcagctgcctgcacagtggactgaccccccacctcaccatggtgcactcctct
tctatcctggccatgcgggatgggcagggcaaccctgacccccaggtccagaagccccac
cccaagccgccccccgttcccaccaagaagccctcctccgtgtccctgtggtcgctggag
cagctgttctgcatcgagctcatccagggcagcaaggtgaatgcggatgagcgcatgaag
ctcgtggtgcaggccgggctcttccacggccatgagatgctatgcaagacagtgtccagc
tcagaggtcagcgtgtgctccgagcctgtgtggaagcagcggctggagtttgacatcagc
atctgcgacctgccgcgcatggcccggctctgcttcgcgctctatgccgtggtggagaaa
gccaagaaggcgcgctccaccaagaagaagtctaagaaggcggactgcccgatcgcctgg
gccaacatcatgctgttcgactaccgggaccagctgaagactggcgagcgccgcctgtac
atgtggccctcggtcccagatgagaaaggtgagctgctgaaccccgcggggagcgtgcac
ggaaaccccaacacagagagcgctgctgccctggtcatcttcctgcccgaggtggccccc
caccccgtgtactaccctgccctggagaagatcctggagctggggagacacggggagcag
cgcggacaaggcacggaggaggagcagctgcagctgagggagatcctggagcggcggggc
tcgggcgagctgtacgagcatgagaaggacctggtgtggaagatgcggcatgaggtccag
gagcacttcccagacgcgctggcccgcctgctgctggtcaccaagtggcacaagcacgag
gatgtggcccagatgctctacctcctgtgctcctggcccgagctgcccatcctgagtgcc
ctggagctgctggacttcagcttccctgactgtcacgtgggctcctttgccatcaggtcc
ctgcggaaactgacggatgatgagctcttccagtacctgctgcagctggtccaggtgctc
aagtatgagtcctacctggactgcgagctgaccaagttcttgctggaccgggcgctggcc
aaccgcaagatcggccacttcctcttctggcatctccgctctgagatgcacgtgccgtca
gtggccctgcgctttggcctcatcatggaggcctattgcaggggcagcacccaccacatg
aaggtgctgatgaagcagggggaagcactgaacaagctgaaggcgctgaatgacttcgtg
aaggtgagctcccagaagaccaccaagccccagaccaaggagctcatgcacctgtgcatg
cggcaggagacctatctggaggcactctcccacctgcagtccccactggacccaagcaca
ctgctggaggaagtgtgcgtggagcagtgcaccttcatggactccaagatgaagccgctg
tggatcatgtacagcagcaaggaggcgggcaccactggcagcgtgggcatcatcttcaag
aacggggatgacctccgccaggacatgctgaccctgcagatgatccagctcatggatgtg
ctatggaagcaggagggcctggacctgaggatgacgccctacggctgcctccccaccggg
gaccgcacgggcctcatcgaggtggtgctgcactcggacaccatcgccaacatccagctg
aacaagagcaacatggcagccacggccgccttcaacaaggacgccctgctcaactggctc
aagtccaagaaccctggggaggccctggagcgagccattgaagagttcaccctgtcctgt
gctggctactgtgtggccacctacgtgctgggcatcggtgaccggcacagcgacaacatc
atgatccgtgagagtgggcagctgttccacattgattttggccacttcctgggaaatttc
aagaccaagtttggaatcaaccgtgagcgggtcccgttcatcctcacctatgacttcgtc
cacgtgattcagcagggaaagacgaataacagcgagaaatttgaaaggttccggggctac
tgcgaacgagcctacaccatcctgcggcgccatggcctcctcttcctccacctctttgca
ctgatgcgggcagcgggcctgcctgagctcagctgctccaaagacatccagtacctcaag
gactccctggcgctggggaaaacagaggaggaggcgctgaagcacttccgggtgaagttc
aacgaagccctcagggagagctggaagaccaaagtgaactggctggcacacaacgtgtcc
aaagataacaggcagtag

KEGG   Heterocephalus glaber (naked mole rat): 101715249
Entry
101715249         CDS       T02812                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00562  Inositol phosphate metabolism
hgl01100  Metabolic pathways
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04070  Phosphatidylinositol signaling system
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04960  Aldosterone-regulated sodium reabsorption
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05100  Bacterial invasion of epithelial cells
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05146  Amoebiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101715249 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101715249 (Pik3cb)
   04014 Ras signaling pathway
    101715249 (Pik3cb)
   04015 Rap1 signaling pathway
    101715249 (Pik3cb)
   04370 VEGF signaling pathway
    101715249 (Pik3cb)
   04630 JAK-STAT signaling pathway
    101715249 (Pik3cb)
   04668 TNF signaling pathway
    101715249 (Pik3cb)
   04066 HIF-1 signaling pathway
    101715249 (Pik3cb)
   04068 FoxO signaling pathway
    101715249 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    101715249 (Pik3cb)
   04072 Phospholipase D signaling pathway
    101715249 (Pik3cb)
   04071 Sphingolipid signaling pathway
    101715249 (Pik3cb)
   04024 cAMP signaling pathway
    101715249 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    101715249 (Pik3cb)
   04152 AMPK signaling pathway
    101715249 (Pik3cb)
   04150 mTOR signaling pathway
    101715249 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101715249 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    101715249 (Pik3cb)
   04218 Cellular senescence
    101715249 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101715249 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    101715249 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101715249 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101715249 (Pik3cb)
   04613 Neutrophil extracellular trap formation
    101715249 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    101715249 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    101715249 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    101715249 (Pik3cb)
   04660 T cell receptor signaling pathway
    101715249 (Pik3cb)
   04662 B cell receptor signaling pathway
    101715249 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    101715249 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    101715249 (Pik3cb)
   04670 Leukocyte transendothelial migration
    101715249 (Pik3cb)
   04062 Chemokine signaling pathway
    101715249 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101715249 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    101715249 (Pik3cb)
   04929 GnRH secretion
    101715249 (Pik3cb)
   04915 Estrogen signaling pathway
    101715249 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    101715249 (Pik3cb)
   04917 Prolactin signaling pathway
    101715249 (Pik3cb)
   04926 Relaxin signaling pathway
    101715249 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    101715249 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    101715249 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101715249 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101715249 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    101715249 (Pik3cb)
   04722 Neurotrophin signaling pathway
    101715249 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101715249 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    101715249 (Pik3cb)
   04380 Osteoclast differentiation
    101715249 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    101715249 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    101715249 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101715249 (Pik3cb)
   05206 MicroRNAs in cancer
    101715249 (Pik3cb)
   05205 Proteoglycans in cancer
    101715249 (Pik3cb)
   05203 Viral carcinogenesis
    101715249 (Pik3cb)
   05230 Central carbon metabolism in cancer
    101715249 (Pik3cb)
   05231 Choline metabolism in cancer
    101715249 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101715249 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101715249 (Pik3cb)
   05212 Pancreatic cancer
    101715249 (Pik3cb)
   05225 Hepatocellular carcinoma
    101715249 (Pik3cb)
   05226 Gastric cancer
    101715249 (Pik3cb)
   05214 Glioma
    101715249 (Pik3cb)
   05221 Acute myeloid leukemia
    101715249 (Pik3cb)
   05220 Chronic myeloid leukemia
    101715249 (Pik3cb)
   05218 Melanoma
    101715249 (Pik3cb)
   05211 Renal cell carcinoma
    101715249 (Pik3cb)
   05215 Prostate cancer
    101715249 (Pik3cb)
   05213 Endometrial cancer
    101715249 (Pik3cb)
   05224 Breast cancer
    101715249 (Pik3cb)
   05222 Small cell lung cancer
    101715249 (Pik3cb)
   05223 Non-small cell lung cancer
    101715249 (Pik3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101715249 (Pik3cb)
   05017 Spinocerebellar ataxia
    101715249 (Pik3cb)
   05020 Prion disease
    101715249 (Pik3cb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101715249 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101715249 (Pik3cb)
   04932 Non-alcoholic fatty liver disease
    101715249 (Pik3cb)
   04931 Insulin resistance
    101715249 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101715249 (Pik3cb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101715249 (Pik3cb)
   05135 Yersinia infection
    101715249 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    101715249 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101715249 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    101715249 (Pik3cb)
   05161 Hepatitis B
    101715249 (Pik3cb)
   05160 Hepatitis C
    101715249 (Pik3cb)
   05171 Coronavirus disease - COVID-19
    101715249 (Pik3cb)
   05164 Influenza A
    101715249 (Pik3cb)
   05162 Measles
    101715249 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    101715249 (Pik3cb)
   05163 Human cytomegalovirus infection
    101715249 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101715249 (Pik3cb)
   05169 Epstein-Barr virus infection
    101715249 (Pik3cb)
   05165 Human papillomavirus infection
    101715249 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101715249 (Pik3cb)
   05142 Chagas disease
    101715249 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101715249 (Pik3cb)
   01524 Platinum drug resistance
    101715249 (Pik3cb)
   01522 Endocrine resistance
    101715249 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101715249 (Pik3cb)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101715249 (Pik3cb)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101715249 (Pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 101715249
NCBI-ProteinID: XP_004834387
UniProt: A0A0P6J4N7
LinkDB
Position
Un
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSIAVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHSYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEEKIQSLVGLSWIDWLKQTYPPEH
DPSILENLEDKLYGGKLIVAVHFENSQDVFSFHVSPNVNPIKINELAIQKRLTIHGKEDE
ASPGDYVLQVIGRVEYVFGDHPLIQFQYVRNCVVNRALPHFVLVECYKIKKMYEQEMIAI
EAAINRNSSNFPLPLPPKKTRIISHVWDNNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNETLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYHYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAISVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCIILSELYIEKCKYMD
SKMKPLWLVYTNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSDEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcagta
gattcacaaatagcttcggatggctccatagctgtggatttccttttacccactgggatt
tatatccagttggaggtaccacgggaagctaccatttcctatattaagcagatgttatgg
aagcaagtgcacagttacccaatgtttaacctgcttatggacattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggaacttgaagatgaaacacgaagactttgc
gatgttagaccttttcttccagttctcaagttagtgacaagaagttgtgatccaggggaa
aaattggactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgcctta
aaggatcctgaagtgaatgaatttcgacgaaaaatgcgcaaattcagtgaggaaaagatt
cagtcacttgtgggattatcgtggattgactggctaaagcaaacctacccaccagaacat
gatccatccatccttgaaaacttggaagacaagctttatggaggaaagctcattgtagct
gttcattttgaaaatagtcaggatgtgtttagctttcatgtatctcctaatgtgaatcct
ataaagataaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
gccagccctggtgactatgtgttacaagtcattgggagagtagaatatgtatttggtgat
cacccactcattcagttccagtacgtccggaactgtgttgtgaacagggccctgccccat
tttgtgcttgtggaatgctacaagatcaagaagatgtatgagcaagaaatgattgccata
gaggctgccataaaccggaattcatctaactttcctcttcccttaccaccaaagaaaaca
cgaattatttctcatgtttgggacaataacaaccctttccaaattgttttggttaaggga
aataaacttaacactgaagaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagcttctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaacactggaatttgatattaatacttgtgacttgccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagtaaaaacgaagaaatcaaccaaaactatt
aatccttctaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcatgg
gtaaataccatggtttttgactttaaaggacagttgaggtctggagacataatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctctgcacattaaatttccagagaataaaaaa
caaccttatcattaccctcccttcgataagattattgaaaaggcagctgaaattgcaagc
agcgatagtgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcagctgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcactgccaaaattactcctgtcaatc
aagtggaataaacttgaagatgttgctcagctccaggcactgcttcagatttggcctaaa
ctgcccccgagggaggccctggagcttctggatttcaactatccagatcagtatgtacgg
gaatatgcagtgggctgcctgcgtcagatgagtgatgaagaactctctcaatatctttta
caactggtccaagttttaaaatatgagccttttcttgattgtgcactttctagatttcta
ttagaaagagcacttgctaatcggagaatagggcagtttctattttggcatctcaggtca
gaggtgcacattcctgccatctcagtacagtttggcgtcatccttgaagcgtactgtcga
ggaagtgtagggcacatgaaagtgctttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtttaatcaaactgaatgcagtgaagttaaacagagctaaagggaaggag
gccatgcacacttgtttaaaacagaatgcttaccgggaagccctctctgatttgcagtca
cctctgaatccatgtatcatcctctcagagctctatattgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctcgtatataccaataaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgactctccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggaccttcggatgctgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcggccttcaataaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaagag
tttaccctatcctgtgctggctactgtgtagcttcttatgtcctcgggattggtgacaga
catagtgacaacataatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatctaaatttggcattaaaagagaacgagtgccttttattctt
acttatgatttcattcatgtcattcaacaaggaaaaacaggaaacacggaaaagtttggc
cgatttcgccagtgttgtgaagatgcatatttgattttacgaagacatggaaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgaacttacatcagtcaaggat
atacagtatcttaaggactctcttgccttaggaaagagtgatgaagaagcactcaaacaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gctcacactgttcggaaagactacagatcttaa

KEGG   Heterocephalus glaber (naked mole rat): 101717096
Entry
101717096         CDS       T02812                                 

Gene name
Pik3r3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04070  Phosphatidylinositol signaling system
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04960  Aldosterone-regulated sodium reabsorption
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05100  Bacterial invasion of epithelial cells
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05146  Amoebiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101717096 (Pik3r3)
   04014 Ras signaling pathway
    101717096 (Pik3r3)
   04015 Rap1 signaling pathway
    101717096 (Pik3r3)
   04370 VEGF signaling pathway
    101717096 (Pik3r3)
   04630 JAK-STAT signaling pathway
    101717096 (Pik3r3)
   04668 TNF signaling pathway
    101717096 (Pik3r3)
   04066 HIF-1 signaling pathway
    101717096 (Pik3r3)
   04068 FoxO signaling pathway
    101717096 (Pik3r3)
   04070 Phosphatidylinositol signaling system
    101717096 (Pik3r3)
   04072 Phospholipase D signaling pathway
    101717096 (Pik3r3)
   04071 Sphingolipid signaling pathway
    101717096 (Pik3r3)
   04024 cAMP signaling pathway
    101717096 (Pik3r3)
   04151 PI3K-Akt signaling pathway
    101717096 (Pik3r3)
   04152 AMPK signaling pathway
    101717096 (Pik3r3)
   04150 mTOR signaling pathway
    101717096 (Pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101717096 (Pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    101717096 (Pik3r3)
   04218 Cellular senescence
    101717096 (Pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101717096 (Pik3r3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101717096 (Pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101717096 (Pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101717096 (Pik3r3)
   04613 Neutrophil extracellular trap formation
    101717096 (Pik3r3)
   04620 Toll-like receptor signaling pathway
    101717096 (Pik3r3)
   04625 C-type lectin receptor signaling pathway
    101717096 (Pik3r3)
   04650 Natural killer cell mediated cytotoxicity
    101717096 (Pik3r3)
   04660 T cell receptor signaling pathway
    101717096 (Pik3r3)
   04662 B cell receptor signaling pathway
    101717096 (Pik3r3)
   04664 Fc epsilon RI signaling pathway
    101717096 (Pik3r3)
   04666 Fc gamma R-mediated phagocytosis
    101717096 (Pik3r3)
   04670 Leukocyte transendothelial migration
    101717096 (Pik3r3)
   04062 Chemokine signaling pathway
    101717096 (Pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101717096 (Pik3r3)
   04923 Regulation of lipolysis in adipocytes
    101717096 (Pik3r3)
   04929 GnRH secretion
    101717096 (Pik3r3)
   04915 Estrogen signaling pathway
    101717096 (Pik3r3)
   04914 Progesterone-mediated oocyte maturation
    101717096 (Pik3r3)
   04917 Prolactin signaling pathway
    101717096 (Pik3r3)
   04926 Relaxin signaling pathway
    101717096 (Pik3r3)
   04935 Growth hormone synthesis, secretion and action
    101717096 (Pik3r3)
   04919 Thyroid hormone signaling pathway
    101717096 (Pik3r3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101717096 (Pik3r3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101717096 (Pik3r3)
  09156 Nervous system
   04725 Cholinergic synapse
    101717096 (Pik3r3)
   04722 Neurotrophin signaling pathway
    101717096 (Pik3r3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101717096 (Pik3r3)
  09158 Development and regeneration
   04360 Axon guidance
    101717096 (Pik3r3)
   04380 Osteoclast differentiation
    101717096 (Pik3r3)
  09149 Aging
   04211 Longevity regulating pathway
    101717096 (Pik3r3)
   04213 Longevity regulating pathway - multiple species
    101717096 (Pik3r3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101717096 (Pik3r3)
   05206 MicroRNAs in cancer
    101717096 (Pik3r3)
   05205 Proteoglycans in cancer
    101717096 (Pik3r3)
   05203 Viral carcinogenesis
    101717096 (Pik3r3)
   05230 Central carbon metabolism in cancer
    101717096 (Pik3r3)
   05231 Choline metabolism in cancer
    101717096 (Pik3r3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101717096 (Pik3r3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101717096 (Pik3r3)
   05212 Pancreatic cancer
    101717096 (Pik3r3)
   05225 Hepatocellular carcinoma
    101717096 (Pik3r3)
   05226 Gastric cancer
    101717096 (Pik3r3)
   05214 Glioma
    101717096 (Pik3r3)
   05221 Acute myeloid leukemia
    101717096 (Pik3r3)
   05220 Chronic myeloid leukemia
    101717096 (Pik3r3)
   05218 Melanoma
    101717096 (Pik3r3)
   05211 Renal cell carcinoma
    101717096 (Pik3r3)
   05215 Prostate cancer
    101717096 (Pik3r3)
   05213 Endometrial cancer
    101717096 (Pik3r3)
   05224 Breast cancer
    101717096 (Pik3r3)
   05222 Small cell lung cancer
    101717096 (Pik3r3)
   05223 Non-small cell lung cancer
    101717096 (Pik3r3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101717096 (Pik3r3)
   05017 Spinocerebellar ataxia
    101717096 (Pik3r3)
   05020 Prion disease
    101717096 (Pik3r3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101717096 (Pik3r3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101717096 (Pik3r3)
   04932 Non-alcoholic fatty liver disease
    101717096 (Pik3r3)
   04931 Insulin resistance
    101717096 (Pik3r3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101717096 (Pik3r3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101717096 (Pik3r3)
   05100 Bacterial invasion of epithelial cells
    101717096 (Pik3r3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101717096 (Pik3r3)
   05170 Human immunodeficiency virus 1 infection
    101717096 (Pik3r3)
   05161 Hepatitis B
    101717096 (Pik3r3)
   05160 Hepatitis C
    101717096 (Pik3r3)
   05171 Coronavirus disease - COVID-19
    101717096 (Pik3r3)
   05164 Influenza A
    101717096 (Pik3r3)
   05162 Measles
    101717096 (Pik3r3)
   05168 Herpes simplex virus 1 infection
    101717096 (Pik3r3)
   05163 Human cytomegalovirus infection
    101717096 (Pik3r3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101717096 (Pik3r3)
   05169 Epstein-Barr virus infection
    101717096 (Pik3r3)
   05165 Human papillomavirus infection
    101717096 (Pik3r3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101717096 (Pik3r3)
   05142 Chagas disease
    101717096 (Pik3r3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101717096 (Pik3r3)
   01524 Platinum drug resistance
    101717096 (Pik3r3)
   01522 Endocrine resistance
    101717096 (Pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101717096 (Pik3r3)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101717096 (Pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act DUF5638 Cupin_8 Fez1 PI_PP_I Exonuc_VII_L
Other DBs
NCBI-GeneID: 101717096
NCBI-ProteinID: XP_004873004
LinkDB
Position
Un
AA seq 417 aa
MISATTNGMKDSSIPLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKIQGDYTLTL
RKGGNNKLIKIYHQDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQ
QDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMNRTAIEAFNETIK
IFEEQCHTQEQHSKEYIERFHREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQ
ALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLSHKGVRQKRLNTWLGIKNEDADETYFIN
EEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHC
VIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgatttcagcaactacaaatggaatgaaggacagttccattcctcttcaagatgcagaa
tggtactggggggatatttccagggaggaagtaaatgacaaattacgggacatgccagat
ggtactttcttggtccgtgatgcctcaacaaaaatccagggagattatactttgactttg
aggaagggaggcaacaataagttaataaagatctatcatcaggatggtaaatatggcttt
tctgatcctctgacatttaattctgtggtggagctcattaaccactatcatcatgaatct
cttgctcagtacaatcccaagcttgatgtgaagctgatgtacccagtgtccaggtaccaa
caggatcagttggtaaaagaagataacattgatgcagtaggtaaaaaactacaagagtac
cactctcagtatcaggaaaagagcaaagaatatgataggctgtatgaagaatataccaga
acatctcaggaaatacagatgaatagaactgcaattgaagcttttaacgaaacaattaaa
atatttgaggaacaatgtcatacacaagaacaacatagcaaagaatatattgagcgattt
cacagagaagggaatgaaaaggagattgaacgaattatgatgaattatgataaattgaaa
tcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggatttgaagaaacaa
gctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacctgacctgatccag
ctgcgcaagattcgagatcagcatcttgtatggctcagtcacaaaggagtgagacagaag
cgcctgaatacatggcttggaattaagaatgaggatgctgatgagacctattttatcaat
gaagaagatgaaaacctgccacattatgatgagaaaacctggtttgttgaggatatcaat
cgagtacaagcagaggacttgctttatgggaaacctgatggtgcattcttaattcgtgag
agtagcaagaaaggatgctatgcctgttctgtggttgccgacggggaggtgaagcactgt
gtgatctacagcactgctcggggatatggcttcgcagagccctacaacctgtacagctcg
ctgaaggagctagtgctccattaccagcagacatccctggttcagcataacgactccctc
aacgtcaggcttgcttaccctgtccatgcacagatgccctcgctgtgcagataa

KEGG   Heterocephalus glaber (naked mole rat): 101718815
Entry
101718815         CDS       T02812                                 

Gene name
Pik3r2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04070  Phosphatidylinositol signaling system
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04960  Aldosterone-regulated sodium reabsorption
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05100  Bacterial invasion of epithelial cells
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05146  Amoebiasis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101718815 (Pik3r2)
   04014 Ras signaling pathway
    101718815 (Pik3r2)
   04015 Rap1 signaling pathway
    101718815 (Pik3r2)
   04370 VEGF signaling pathway
    101718815 (Pik3r2)
   04630 JAK-STAT signaling pathway
    101718815 (Pik3r2)
   04668 TNF signaling pathway
    101718815 (Pik3r2)
   04066 HIF-1 signaling pathway
    101718815 (Pik3r2)
   04068 FoxO signaling pathway
    101718815 (Pik3r2)
   04070 Phosphatidylinositol signaling system
    101718815 (Pik3r2)
   04072 Phospholipase D signaling pathway
    101718815 (Pik3r2)
   04071 Sphingolipid signaling pathway
    101718815 (Pik3r2)
   04024 cAMP signaling pathway
    101718815 (Pik3r2)
   04151 PI3K-Akt signaling pathway
    101718815 (Pik3r2)
   04152 AMPK signaling pathway
    101718815 (Pik3r2)
   04150 mTOR signaling pathway
    101718815 (Pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101718815 (Pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    101718815 (Pik3r2)
   04218 Cellular senescence
    101718815 (Pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101718815 (Pik3r2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101718815 (Pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101718815 (Pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101718815 (Pik3r2)
   04613 Neutrophil extracellular trap formation
    101718815 (Pik3r2)
   04620 Toll-like receptor signaling pathway
    101718815 (Pik3r2)
   04625 C-type lectin receptor signaling pathway
    101718815 (Pik3r2)
   04650 Natural killer cell mediated cytotoxicity
    101718815 (Pik3r2)
   04660 T cell receptor signaling pathway
    101718815 (Pik3r2)
   04662 B cell receptor signaling pathway
    101718815 (Pik3r2)
   04664 Fc epsilon RI signaling pathway
    101718815 (Pik3r2)
   04666 Fc gamma R-mediated phagocytosis
    101718815 (Pik3r2)
   04670 Leukocyte transendothelial migration
    101718815 (Pik3r2)
   04062 Chemokine signaling pathway
    101718815 (Pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101718815 (Pik3r2)
   04923 Regulation of lipolysis in adipocytes
    101718815 (Pik3r2)
   04929 GnRH secretion
    101718815 (Pik3r2)
   04915 Estrogen signaling pathway
    101718815 (Pik3r2)
   04914 Progesterone-mediated oocyte maturation
    101718815 (Pik3r2)
   04917 Prolactin signaling pathway
    101718815 (Pik3r2)
   04926 Relaxin signaling pathway
    101718815 (Pik3r2)
   04935 Growth hormone synthesis, secretion and action
    101718815 (Pik3r2)
   04919 Thyroid hormone signaling pathway
    101718815 (Pik3r2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101718815 (Pik3r2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101718815 (Pik3r2)
  09156 Nervous system
   04725 Cholinergic synapse
    101718815 (Pik3r2)
   04722 Neurotrophin signaling pathway
    101718815 (Pik3r2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101718815 (Pik3r2)
  09158 Development and regeneration
   04360 Axon guidance
    101718815 (Pik3r2)
   04380 Osteoclast differentiation
    101718815 (Pik3r2)
  09149 Aging
   04211 Longevity regulating pathway
    101718815 (Pik3r2)
   04213 Longevity regulating pathway - multiple species
    101718815 (Pik3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718815 (Pik3r2)
   05206 MicroRNAs in cancer
    101718815 (Pik3r2)
   05205 Proteoglycans in cancer
    101718815 (Pik3r2)
   05203 Viral carcinogenesis
    101718815 (Pik3r2)
   05230 Central carbon metabolism in cancer
    101718815 (Pik3r2)
   05231 Choline metabolism in cancer
    101718815 (Pik3r2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101718815 (Pik3r2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101718815 (Pik3r2)
   05212 Pancreatic cancer
    101718815 (Pik3r2)
   05225 Hepatocellular carcinoma
    101718815 (Pik3r2)
   05226 Gastric cancer
    101718815 (Pik3r2)
   05214 Glioma
    101718815 (Pik3r2)
   05221 Acute myeloid leukemia
    101718815 (Pik3r2)
   05220 Chronic myeloid leukemia
    101718815 (Pik3r2)
   05218 Melanoma
    101718815 (Pik3r2)
   05211 Renal cell carcinoma
    101718815 (Pik3r2)
   05215 Prostate cancer
    101718815 (Pik3r2)
   05213 Endometrial cancer
    101718815 (Pik3r2)
   05224 Breast cancer
    101718815 (Pik3r2)
   05222 Small cell lung cancer
    101718815 (Pik3r2)
   05223 Non-small cell lung cancer
    101718815 (Pik3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101718815 (Pik3r2)
   05017 Spinocerebellar ataxia
    101718815 (Pik3r2)
   05020 Prion disease
    101718815 (Pik3r2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101718815 (Pik3r2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101718815 (Pik3r2)
   04932 Non-alcoholic fatty liver disease
    101718815 (Pik3r2)
   04931 Insulin resistance
    101718815 (Pik3r2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101718815 (Pik3r2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101718815 (Pik3r2)
   05100 Bacterial invasion of epithelial cells
    101718815 (Pik3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101718815 (Pik3r2)
   05170 Human immunodeficiency virus 1 infection
    101718815 (Pik3r2)
   05161 Hepatitis B
    101718815 (Pik3r2)
   05160 Hepatitis C
    101718815 (Pik3r2)
   05171 Coronavirus disease - COVID-19
    101718815 (Pik3r2)
   05164 Influenza A
    101718815 (Pik3r2)
   05162 Measles
    101718815 (Pik3r2)
   05168 Herpes simplex virus 1 infection
    101718815 (Pik3r2)
   05163 Human cytomegalovirus infection
    101718815 (Pik3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101718815 (Pik3r2)
   05169 Epstein-Barr virus infection
    101718815 (Pik3r2)
   05165 Human papillomavirus infection
    101718815 (Pik3r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101718815 (Pik3r2)
   05142 Chagas disease
    101718815 (Pik3r2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101718815 (Pik3r2)
   01524 Platinum drug resistance
    101718815 (Pik3r2)
   01522 Endocrine resistance
    101718815 (Pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101718815 (Pik3r2)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101718815 (Pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e ATG11 Bap31_Bap29_C
Other DBs
NCBI-GeneID: 101718815
NCBI-ProteinID: XP_004873393
LinkDB
Position
Un
AA seq 728 aa
MAGTEGFQYRALYPFRRERPEDLELLPGDMLVVSRAALQALGVAEGGERCPNSVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDEPQEPGLTLPDLPEQFAP
PDMAPPILARLVEAIEQTGLDTESHCRPELPALRTDWSLSDLDQWDAGALSDAIKGFLLA
LPAPLVTPEAAAEAHRALRGATGPVGPALEPPTLPLHRALTLRFLLQHLGRAARRAPAPG
PAVRALAAAFGPLLLLRAPSPPQPPAGAPPEGTEPSQDFPVLLAEKLLQEHLEEQEAAPP
ALPPKPSKPKPAAPGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFRSVVDLITHYRHESLAQYNAKLDTR
LLYPVSRLQQDQVVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQERCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQDLRAQASDNREIDKRMNSLKPDLLQLRKIRDQYLVWLTQKGARQKKINEWLGIRNE
TEDQYALMEDEEDLPHHEERTWYVGKINRTQAEGMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPG
PGPPPPGR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggcaggcaccgagggcttccagtaccgcgcgctgtacccgttccggcgagagcggcct
gaggacctggagctgctgcctggcgacatgctggtggtgagccgtgcggccctgcaggcg
ctcggtgtggcggagggcggcgagcgctgcccgaacagtgtgggctggatgcctggcttc
aacgagcgcacacggcagcggggcgacttcccgggcacctacgtggagttcctggggccc
gtggccctggcccggcctggccctcgcccacgcggcccccgcccactgcccgccaggccc
cgagatgagccccaggagccaggcctcacgctcccagatctgcctgagcagtttgcccct
cctgacatggcgccccctatcctggcgaggctggtggaggccatagagcagacagggctg
gacaccgagtcccactgcaggccggagctacccgcgctgcgcacagactggtcgctgagc
gacctggaccagtgggacgccggcgctctgtccgacgccatcaagggcttcctgctggcc
ttgcctgccccgcttgtgactcctgaggcggcggccgaggcgcaccgggccctgcggggc
gccacggggcccgtgggcccagcactggaacccccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctgcagcacctgggccgggcggcccgccgcgcccccgccccgggt
cccgccgtccgtgccctggctgcggccttcgggccactgctgctgctgcgtgcaccgtcg
cctccgcagccgccagcgggcgccccgccagaagggacggagcccagccaggacttcccg
gtgctgctggcggagaagctgctacaggaacatctggaggagcaggaggccgcgccccca
gccctgccgcccaagccctccaagccaaagccggccgccccgggcttggccaacgggggc
agcccgccctccctgcaggacgcggagtggtactggggtgacatctccagggaggaggtg
aacgagaagctccgcgatactcccgacggcaccttcctggtccgcgatgcatccagcaag
atccagggggagtacacgctcaccctcaggaagggcggcaacaacaagctgatcaaggtc
ttccaccgggacggccactacggcttctcggagccgctgaccttccgctcggtagtggac
ctcatcacgcactaccgccatgagtcgctggcccagtacaacgccaagctggacacgagg
ctgctctatcccgtgtcgcggctgcagcaggaccaggtggtcaaggaggacagcgtggag
gccgtgggcgcccagctgaaggtctaccaccagcagtaccaggacaagagccgcgagtac
gaccagctctacgaggaatacacgcgcacctcccaggagctgcagatgaagcgcacggca
atcgaggccttcaacgagaccatcaagatcttcgaagagcagggccagactcaggagagg
tgcagcaaagaatatctggagcgattccggcgtgagggcaatgagaaggagatgcagagg
atcctgctcaactctgagcggctgaagtcccgcatcgccgagattcacgagagccgcacg
aagctggagcaggacttgcgggcccaggcctcggacaaccgcgagatcgacaagcgcatg
aacagcctcaagcctgacctcctgcagctgcgcaagatccgcgaccagtacctcgtgtgg
ctcactcagaaaggtgcccggcagaagaagatcaacgagtggctggggatcagaaacgag
accgaggaccagtacgcgctgatggaggatgaggaagatctcccccaccacgaggaacgc
acgtggtatgtgggcaagatcaaccgcacgcaggccgagggcatgctgagcggcaagagg
gatggcacgttcctcatccgggagagcagccagcgcggctgctatgcctgctctgtggtg
gtggacggcgacaccaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcg
gagccctacaacctgtacgggtcgctgaaggagctggtgctgcactaccagcacgcgtcc
ctggtgcagcacaacgacgccctcaccgtcaccctggcgcaccccgtgcgcgccccaggg
cccggcccgccgccccccggccgctga

DBGET integrated database retrieval system