KEGG   Heterocephalus glaber (naked mole rat): 101703701
Entry
101703701         CDS       T02812                                 

Gene name
Rb1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04110  Cell cycle
hgl04218  Cellular senescence
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101703701 (Rb1)
   04218 Cellular senescence
    101703701 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101703701 (Rb1)
   05203 Viral carcinogenesis
    101703701 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101703701 (Rb1)
   05225 Hepatocellular carcinoma
    101703701 (Rb1)
   05226 Gastric cancer
    101703701 (Rb1)
   05214 Glioma
    101703701 (Rb1)
   05220 Chronic myeloid leukemia
    101703701 (Rb1)
   05218 Melanoma
    101703701 (Rb1)
   05219 Bladder cancer
    101703701 (Rb1)
   05215 Prostate cancer
    101703701 (Rb1)
   05224 Breast cancer
    101703701 (Rb1)
   05222 Small cell lung cancer
    101703701 (Rb1)
   05223 Non-small cell lung cancer
    101703701 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101703701 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101703701 (Rb1)
   05161 Hepatitis B
    101703701 (Rb1)
   05160 Hepatitis C
    101703701 (Rb1)
   05163 Human cytomegalovirus infection
    101703701 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101703701 (Rb1)
   05169 Epstein-Barr virus infection
    101703701 (Rb1)
   05165 Human papillomavirus infection
    101703701 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101703701 (Rb1)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101703701 (Rb1)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    101703701 (Rb1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 101703701
NCBI-ProteinID: XP_004844243
UniProt: A0A0P6JI57
LinkDB
Position
Un
AA seq 924 aa
MPPKTPRRAAATAVEPPPPPPPPPPEEDPEQDSGPEDLPLARFEFEEAEEPDFTALCQKL
KIADCVRERAWLTWEKVSSVDGVLKGYIQKKMELWGICIFIAAVDLDEMPFTFTELQKNI
ETSVYKFFDLVKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTPPSSSISAE
ISSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPAALLKEPYKTAVI
PINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLG
IVTSNGLPEVESLSKQYEEIYLKNKDIDARLFLDHDKTLQTDPIDSFEMQRTPQKSNPDE
EVNVIPPHTPVRTVMNTIQQLMMILNSSSDQPSEILISYFNNCTVNPKENILKRVKDIGH
IFKEKFANAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNVFHM
SLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEANLTR
EMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDQEGPAEHLESTCPLNLPLQNNHTAAD
MYLSPIRSPKRKGSTTRGNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNT
LCARLLSDHPELEHIIWTLFQHTLQNEYELMKDRHLDQIMMCSMYGICKVKNIDLKFKII
VTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPH
IPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEK
FQKINQMVGNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEM
TSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgccgcccaaaacccccagaagagcagccgccaccgcggtagaacccccgccaccgccg
ccgccgccccctcctgaggaggacccagagcaggacagtggccccgaggacttgcctctg
gccaggtttgagttcgaagaagctgaagaacctgattttactgcattatgtcagaaatta
aagatagcagattgtgtcagagaaagggcttggttaacttgggagaaagtttcatctgtg
gacggagtattgaaaggttatattcaaaagaaaatggaactatggggaatctgtatcttt
attgcagcggttgacctagatgagatgccattcacttttactgagctacagaaaaatata
gaaaccagtgtctataaattctttgatttagtaaaagaaattgataccagtaccaaagtt
gataatgctatgtcaagactattgaagaagtacaatgtattgtgtgcactctacagcaaa
ttagaaaggacatgtgaacttatatatttgacaccacccagcagttcaatatctgccgaa
ataagttctgcgttggtgctgaaagtttcttggatcacatttttactagctaaaggagaa
gtattgcaaatggaagatgacctggtgatttcttttcagttaatgctatgtgtgcttgac
tattttataaaactttcacctgctgcactcctcaaagaaccatataaaacagctgtaatt
cccattaatggctcacctcgaacacccaggcgaggtcagaacaggagtgcgcggatagca
aaacaactagaaaatgacacaagaattattgaagttctctgtaaagaacatgaatgtaat
atagatgaggtgaaaaatgtttattttaaaaactttataccttttatgaactctcttgga
atagtaacttctaatggacttccagaggttgaaagtctgtctaaacagtatgaagaaatt
tatcttaaaaacaaagatatagatgcaagattatttttggatcatgataaaactcttcag
actgatcctatagacagttttgaaatgcagagaacaccacagaaaagtaaccctgatgaa
gaggtaaatgtgattcctccacatactccagttaggactgttatgaatactattcaacaa
ttaatgatgattttaaattcatcaagtgatcaaccatcagaaattctgatttcctatttc
aataattgcacagtgaatccaaaagaaaatattctgaaaagagtgaaggatattggacac
atctttaaagagaaatttgctaatgctgttggacagggatgtgttgagattggatcacag
cgatacaaacttggagtccgattgtactaccgagtgatggaatccatgcttaaatcagaa
gaagaacgattatccattcaaaattttagcaaacttttgaatgacaacgtctttcatatg
tctttattggcctgtgctcttgaagttgtaatggctacatatagcagaagtacatctcag
aatcttgattctggaacagatttatccttcccatggattctgaatgtacttaatttaaaa
gcctttgatttttacaaagtgattgagagttttatcaaagcagaagccaacttgacaaga
gaaatgataaaacatttagaaagatgtgaacatcgaatcatggaatcccttgcatggctc
tcagattcccctttatttgatcttattaaacagtcaaaagatcaagaaggaccagctgaa
caccttgaatctacttgtccactcaaccttcctctccaaaataatcacactgcagctgat
atgtatctttctcctataagatcgccaaagagaaaaggttcaactacacgtggaaattct
actgcaaacgcagagacacaagcaacctcagccttccagactcagaagccattgaaatct
acctccctttccctcttttacaaaaaagtgtaccgattagcatatctccgactaaatact
ctgtgtgcacgccttctgtctgaccacccagaactagagcacatcatctggacccttttt
cagcatacactgcaaaatgagtatgagctgatgaaagacagacatttggaccaaattatg
atgtgttctatgtatggcatatgcaaagtgaagaatatagaccttaaattcaaaatcatt
gtaactgcatacaaggatctccctcatgctgttcaggagacattcaaaagagttttgatt
agagaagaggagtatgattccattatagtattctacaactcagttttcatgcaaagactg
aaaacaaacattttgcagtatgcttccacgaggcctcctaccttgtcaccaatacctcac
attcctcgaagcccttacaagttttctagttcacccttacgaattcctggggggaacatc
tatatatcaccgctgaagagtccatacaaaatttcagaaggtctaccaacgccaacaaaa
atgactccgagatcaagaatcctagtgtcaattggtgaatcatttgggacttctgagaag
ttccagaaaataaatcagatggtaggtaatagtgaccgtgtactcaaaagaagtgctgaa
ggaagcaatcctcctaaaccactgaaaaaactacgctttgacatcgaaggatcagatgaa
gcagacggaagtaaacatcttccaggcgagtctaaatttcaacagaaactagcagaaatg
acatctactagaacacgaatgcaaaaacagaaaatgaatgacagcatggatacctcaaac
aaggaagaaaagtga

DBGET integrated database retrieval system