KEGG   Heterocephalus glaber (naked mole rat): 101703764
Entry
101703764         CDS       T02812                                 

Gene name
Smad4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04310  Wnt signaling pathway
hgl04350  TGF-beta signaling pathway
hgl04371  Apelin signaling pathway
hgl04390  Hippo signaling pathway
hgl04520  Adherens junction
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04659  Th17 cell differentiation
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05161  Hepatitis B
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101703764 (Smad4)
   04350 TGF-beta signaling pathway
    101703764 (Smad4)
   04390 Hippo signaling pathway
    101703764 (Smad4)
   04371 Apelin signaling pathway
    101703764 (Smad4)
   04068 FoxO signaling pathway
    101703764 (Smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101703764 (Smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101703764 (Smad4)
   04550 Signaling pathways regulating pluripotency of stem cells
    101703764 (Smad4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101703764 (Smad4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101703764 (Smad4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101703764 (Smad4)
   05212 Pancreatic cancer
    101703764 (Smad4)
   05225 Hepatocellular carcinoma
    101703764 (Smad4)
   05226 Gastric cancer
    101703764 (Smad4)
   05220 Chronic myeloid leukemia
    101703764 (Smad4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101703764 (Smad4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101703764 (Smad4)
   05161 Hepatitis B
    101703764 (Smad4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101703764
NCBI-ProteinID: XP_004855225
UniProt: G5BVT2
LinkDB
Position
Un
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASAETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcttgcctgagcattgta
catagtttgatgtgccatagacagggtggagaaagtgaaacatttgcaaaaagagcaatt
gaaagtttagtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgactgtggagg
tggcctgatcttcacaaaaatgaactgaagcacgttaaatattgtcagtatgcatttgat
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcgttatccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcatcagcagagacatacagcactccagctctg
ttggccccatctgagtctaatgctaccagcaccacaaactttcccaacattcctgtggct
tctacaagtcagcctgccagtattctggcaggcagccatagtgaaggactgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtagaactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcctggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgtaactgttgatggatacgtggatccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccatgcagtctttgtacagagttactacttagacagagaagctggacgt
gcacctggagatgctgttcataagatctacccaagtgcgtatataaaggtctttgacttg
cgtcagtgtcatcgacagatgcagcagcaggcagctactgcgcaagctgcagcagctgcc
caagcagcagccgtggcaggaaacatccctggtcctggatcagtaggtggaatagctccg
gctattagtctgtcagcggctgccggcattggtgtagatgaccttcgtcgcttatgcata
ctcaggatgagctttgtgaaaggctggggacctgattacccaagacagagtatcaaagaa
acgccttgctggattgagattcacttacaccgggccctccaacttctagatgaagtactt
cataccatgcctattgcagatccacaacctttagactga

DBGET integrated database retrieval system