KEGG   Heterocephalus glaber (naked mole rat): 101704230
Entry
101704230         CDS       T02812                                 

Gene name
Tgfb1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04218  Cellular senescence
hgl04350  TGF-beta signaling pathway
hgl04380  Osteoclast differentiation
hgl04390  Hippo signaling pathway
hgl04659  Th17 cell differentiation
hgl04672  Intestinal immune network for IgA production
hgl04926  Relaxin signaling pathway
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05144  Malaria
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05321  Inflammatory bowel disease
hgl05323  Rheumatoid arthritis
hgl05410  Hypertrophic cardiomyopathy
hgl05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101704230 (Tgfb1)
   04350 TGF-beta signaling pathway
    101704230 (Tgfb1)
   04390 Hippo signaling pathway
    101704230 (Tgfb1)
   04068 FoxO signaling pathway
    101704230 (Tgfb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101704230 (Tgfb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101704230 (Tgfb1)
   04218 Cellular senescence
    101704230 (Tgfb1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101704230 (Tgfb1)
   04672 Intestinal immune network for IgA production
    101704230 (Tgfb1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101704230 (Tgfb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101704230 (Tgfb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101704230 (Tgfb1)
   05205 Proteoglycans in cancer
    101704230 (Tgfb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101704230 (Tgfb1)
   05212 Pancreatic cancer
    101704230 (Tgfb1)
   05225 Hepatocellular carcinoma
    101704230 (Tgfb1)
   05226 Gastric cancer
    101704230 (Tgfb1)
   05220 Chronic myeloid leukemia
    101704230 (Tgfb1)
   05211 Renal cell carcinoma
    101704230 (Tgfb1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101704230 (Tgfb1)
   05321 Inflammatory bowel disease
    101704230 (Tgfb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101704230 (Tgfb1)
   05414 Dilated cardiomyopathy
    101704230 (Tgfb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101704230 (Tgfb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101704230 (Tgfb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101704230 (Tgfb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101704230 (Tgfb1)
   05161 Hepatitis B
    101704230 (Tgfb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101704230 (Tgfb1)
   05144 Malaria
    101704230 (Tgfb1)
   05145 Toxoplasmosis
    101704230 (Tgfb1)
   05140 Leishmaniasis
    101704230 (Tgfb1)
   05142 Chagas disease
    101704230 (Tgfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hgl03110]
    101704230 (Tgfb1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101704230 (Tgfb1)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101704230 (Tgfb1)
Chaperones and folding catalysts [BR:hgl03110]
 Intramolecular chaperones
  Others
   101704230 (Tgfb1)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101704230 (Tgfb1)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101704230 (Tgfb1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 101704230
NCBI-ProteinID: XP_004873050
UniProt: A0A0P6K6G7
LinkDB
Position
Un
AA seq 390 aa
MPPFRLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAESEPEPEPDYYAKEVTRVLMVENNHNI
YKSIETVAHSVYMFFNTSEIREAVPDPLLLSRAELRMQRLKLSVEQHVELYQKYSNNSWR
YLSNRLLTPSDTPEWLSFDVTGVVRQWLIQREELQGFRFSAHCSCDSKDNTLRVDINGIG
PKRRGDLGAIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKAKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgcccttccggctgcggctgctgccgcttctgctaccgctactgtggctactggtg
ctgacgcctggccggccagctgcgggtctgtccacctgcaagaccatcgatatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaaattacggctcgcc
agcccccccagccagggggaggtaccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagcgccgagtcggaacccgagcccgag
ccggactactatgccaaggaggtcacccgcgtgctaatggtggagaacaaccacaatatc
tataaaagcatcgagactgttgcacacagtgtatatatgttcttcaacacatcagagatc
cgggaagctgtgcctgaccctctgttgttgtcgcgggcagagctgcgtatgcagagactc
aagttaagtgtggagcaacacgtggaactgtaccaaaaatacagcaacaattcctggcgc
tacctcagcaaccggctcctgacccccagtgatacaccggagtggctgtcctttgatgtc
actggagttgttcggcagtggctgatccaaagagaggaattacagggctttcgcttcagt
gctcactgctcctgtgacagcaaagataacacactccgagtggacatcaacgggatcggt
cctaaacgccggggtgacctgggggccattcatggaatgaaccgccccttcctgctcctc
atggccaccccactggagagggcccagcacctgcacagctcccgacaccgccgagccctg
gacacaaactactgcttcagctccacggagaagaactgctgtgttcggcagctctacatt
gacttccgcaaggacctgggatggaagtggatccacgagcccaagggctaccacgccaac
ttctgcctagggccctgtccctacatttggagcctggacacacagtacagcaaggtcctg
gccctgtacaaccagcacaacccgggggcgtcggcggcgccctgctgcgtgccgcaggca
ctggagccgctgcccatcgtgtactacgtgggccgcaaagccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaaatgcagctga

KEGG   Heterocephalus glaber (naked mole rat): 101707457
Entry
101707457         CDS       T02812                                 

Gene name
Tgfb2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04218  Cellular senescence
hgl04350  TGF-beta signaling pathway
hgl04380  Osteoclast differentiation
hgl04390  Hippo signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05144  Malaria
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05321  Inflammatory bowel disease
hgl05323  Rheumatoid arthritis
hgl05410  Hypertrophic cardiomyopathy
hgl05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101707457 (Tgfb2)
   04350 TGF-beta signaling pathway
    101707457 (Tgfb2)
   04390 Hippo signaling pathway
    101707457 (Tgfb2)
   04068 FoxO signaling pathway
    101707457 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101707457 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101707457 (Tgfb2)
   04218 Cellular senescence
    101707457 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101707457 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101707457 (Tgfb2)
   05206 MicroRNAs in cancer
    101707457 (Tgfb2)
   05205 Proteoglycans in cancer
    101707457 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101707457 (Tgfb2)
   05212 Pancreatic cancer
    101707457 (Tgfb2)
   05225 Hepatocellular carcinoma
    101707457 (Tgfb2)
   05226 Gastric cancer
    101707457 (Tgfb2)
   05220 Chronic myeloid leukemia
    101707457 (Tgfb2)
   05211 Renal cell carcinoma
    101707457 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101707457 (Tgfb2)
   05321 Inflammatory bowel disease
    101707457 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101707457 (Tgfb2)
   05414 Dilated cardiomyopathy
    101707457 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101707457 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101707457 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101707457 (Tgfb2)
   05161 Hepatitis B
    101707457 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101707457 (Tgfb2)
   05144 Malaria
    101707457 (Tgfb2)
   05145 Toxoplasmosis
    101707457 (Tgfb2)
   05140 Leishmaniasis
    101707457 (Tgfb2)
   05142 Chagas disease
    101707457 (Tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101707457 (Tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101707457 (Tgfb2)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101707457 (Tgfb2)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101707457 (Tgfb2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 101707457
NCBI-ProteinID: XP_004867449
UniProt: A0A0P6K2D3
LinkDB
Position
Un
AA seq 412 aa
MHSRVLSALLTLHLVPAALALSTCSSLDMDQFMRKRIEAIRGQILSKLKLTSPPDDFPEP
DEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMRFFSENAIPPPF
YRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPNQ
RYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNK
SEELEARFAGIDGTSTYTSGDQKTIKSTRKTNSGKTPHLLLMLLPSYRLESPPSNRRKKR
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSR
VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcactcccgcgtgctgagcgcgctgctgaccctgcatctggtgcctgcggcgctcgcc
ctgtctacctgcagctcgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctcagcaagctgaagctcaccagccccccggacgacttccccgagccc
gacgaggtgcccccggaggtcatctccatctacaacagcacgcgggacctgctgcaggag
aaggcgagccgccgggccgccgcctgcgagcgcgagcgcagcgacgaggagtactacgcc
aaggaggtctacaagatcgacatgcgcttcttctccgaaaatgccatcccgccccctttc
tacagaccctacttcagaatcgtccgatttgatgtctcggcaatggagaaaaacgcttcc
aatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccagagtgccc
gagcaacggatcgagctgtaccagattctcaagtccaaagatttaacctctccaaaccag
cgctacatcgacagcaaagttgtgaaaacaagagcggaaggcgagtggctgtccttcgat
gtgacggatgctgtccatgagtggcttcaccataaagacaggaaccttggatttaaaata
agtttacactgtccctgctgcacctttgtgccatctaataattacatcatacccaataaa
agtgaagagctagaggcaagatttgcaggtattgatggcacctccacatataccagtggt
gatcagaaaactataaagtccactaggaaaacaaacagtgggaagaccccacatctcctg
ctaatgttattgccctcctacagacttgagtcaccaccgtctaaccggcggaagaagcgt
gctttggatgcggcttattgctttagaaatgtgcaggacaattgctgcctgcgtccactt
tacattgatttcaagagggatcttgggtggaaatggattcatgaacccaaaggctacaat
gccaacttctgtgctggggcctgcccgtatctgtggagctccgacactcagcacagcagg
gtcctcagcttgtacaacaccataaacccagaggcctctgcatctccgtgctgtgtgtcg
caggacctggagccgctcaccatcctctactacatcggcaagacccccaagatcgagcag
ctctccaacatgatcgtcaagtcctgcaaatgcagctaa

KEGG   Heterocephalus glaber (naked mole rat): 101712904
Entry
101712904         CDS       T02812                                 

Gene name
Tgfb3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04218  Cellular senescence
hgl04350  TGF-beta signaling pathway
hgl04390  Hippo signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05144  Malaria
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05321  Inflammatory bowel disease
hgl05323  Rheumatoid arthritis
hgl05410  Hypertrophic cardiomyopathy
hgl05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101712904 (Tgfb3)
   04350 TGF-beta signaling pathway
    101712904 (Tgfb3)
   04390 Hippo signaling pathway
    101712904 (Tgfb3)
   04068 FoxO signaling pathway
    101712904 (Tgfb3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101712904 (Tgfb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101712904 (Tgfb3)
   04218 Cellular senescence
    101712904 (Tgfb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101712904 (Tgfb3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101712904 (Tgfb3)
   05212 Pancreatic cancer
    101712904 (Tgfb3)
   05225 Hepatocellular carcinoma
    101712904 (Tgfb3)
   05226 Gastric cancer
    101712904 (Tgfb3)
   05220 Chronic myeloid leukemia
    101712904 (Tgfb3)
   05211 Renal cell carcinoma
    101712904 (Tgfb3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101712904 (Tgfb3)
   05321 Inflammatory bowel disease
    101712904 (Tgfb3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101712904 (Tgfb3)
   05414 Dilated cardiomyopathy
    101712904 (Tgfb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101712904 (Tgfb3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101712904 (Tgfb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101712904 (Tgfb3)
   05161 Hepatitis B
    101712904 (Tgfb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101712904 (Tgfb3)
   05144 Malaria
    101712904 (Tgfb3)
   05145 Toxoplasmosis
    101712904 (Tgfb3)
   05140 Leishmaniasis
    101712904 (Tgfb3)
   05142 Chagas disease
    101712904 (Tgfb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101712904 (Tgfb3)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101712904 (Tgfb3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 101712904
NCBI-ProteinID: XP_004837211
UniProt: A0A0P6JFB7
LinkDB
Position
Un
AA seq 412 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMQGEKEEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKIFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIQEVMEIKFKGMDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtg
gaagccattagaggacagatcttgagcaagctcaggctcaccagcccccctgagccatca
gtgatgacccatgtcccctatcaagtcttggccctgtataacagcacccgggagctgctg
gaagagatgcagggggagaaggaggaaggctgcactcaggaaaacaccgaatcagaatac
tatgccaaagagatccataagttcgacatgatccaggggctggcagagcacaatgagctg
gctgtctgccccaaaggaattacctccaagatcttccgcttcaatgtgtcctcagtggag
aaaaatggaaccaacctgttccgggcagaattccgggtcttgcgggtgcccaaccccagt
tccaagcgcactgagcagaggattgagctcttccagattctccggccagatgagcacatc
gccaaacagcgctatatcggtggcaagaatttgcccacccggggcactgccgagtggctg
tcttttgatgtcactgacactgtgcgtgagtggctgttgcgaagagagtccaacttaggt
ctggaaatcagcattcattgtccatgtcacacctttcagcccaacggagatatcctggaa
aacattcaagaggtgatggaaatcaaattcaaagggatggacaatgaggatgaccatggc
cgtggagacctggggcgccttaagaaacagaaggatcaccacaaccctcacctaatcttg
atgatgattcccccacaccggctcgacaaccctggccaaggcgggcagaggaagaagcgg
gccctggacaccaactactgcttccgcaacttggaagagaactgctgcgtgcgccccctc
tacattgacttcagacaggatctgggctggaagtgggtccacgaacctaaggggtactat
gccaacttctgctcaggcccttgcccgtacctccgaagtgcagacacgacccacagcacg
gtgctgggactatacaacaccctgaatccggaagcgtctgcctccccctgctgtgtgccc
caggacttggagcccctgaccatcctgtactatgtggggaggaccccgaaggtggagcag
ctctccaacatggtggtgaagtcatgtaagtgtagctga

DBGET integrated database retrieval system