KEGG   Heterocephalus glaber (naked mole rat): 101704740
Entry
101704740         CDS       T02812                                 

Gene name
Myc
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04110  Cell cycle
hgl04151  PI3K-Akt signaling pathway
hgl04218  Cellular senescence
hgl04310  Wnt signaling pathway
hgl04350  TGF-beta signaling pathway
hgl04390  Hippo signaling pathway
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04630  JAK-STAT signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl05132  Salmonella infection
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05213  Endometrial cancer
hgl05216  Thyroid cancer
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101704740 (Myc)
   04012 ErbB signaling pathway
    101704740 (Myc)
   04310 Wnt signaling pathway
    101704740 (Myc)
   04350 TGF-beta signaling pathway
    101704740 (Myc)
   04390 Hippo signaling pathway
    101704740 (Myc)
   04630 JAK-STAT signaling pathway
    101704740 (Myc)
   04151 PI3K-Akt signaling pathway
    101704740 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101704740 (Myc)
   04218 Cellular senescence
    101704740 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101704740 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101704740 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101704740 (Myc)
   05202 Transcriptional misregulation in cancer
    101704740 (Myc)
   05206 MicroRNAs in cancer
    101704740 (Myc)
   05205 Proteoglycans in cancer
    101704740 (Myc)
   05230 Central carbon metabolism in cancer
    101704740 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101704740 (Myc)
   05225 Hepatocellular carcinoma
    101704740 (Myc)
   05226 Gastric cancer
    101704740 (Myc)
   05216 Thyroid cancer
    101704740 (Myc)
   05221 Acute myeloid leukemia
    101704740 (Myc)
   05220 Chronic myeloid leukemia
    101704740 (Myc)
   05219 Bladder cancer
    101704740 (Myc)
   05213 Endometrial cancer
    101704740 (Myc)
   05224 Breast cancer
    101704740 (Myc)
   05222 Small cell lung cancer
    101704740 (Myc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101704740 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101704740 (Myc)
   05161 Hepatitis B
    101704740 (Myc)
   05160 Hepatitis C
    101704740 (Myc)
   05163 Human cytomegalovirus infection
    101704740 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101704740 (Myc)
   05169 Epstein-Barr virus infection
    101704740 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101704740 (Myc)
   03019 Messenger RNA biogenesis [BR:hgl03019]
    101704740 (Myc)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    101704740 (Myc)
Messenger RNA biogenesis [BR:hgl03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101704740 (Myc)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ TFIIE-A_C
Other DBs
NCBI-GeneID: 101704740
NCBI-ProteinID: XP_004838015
LinkDB
Position
Un
AA seq 434 aa
MPLSVSFASRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPGGDDGGGGGGGSFSTADQLEMVTELLGGDMVNQSFICD
PDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARRDSASPSPARGPGCSTSSLYLQ
DLSAAASQCIDPSVVFPYPLSESGSPKPCASPDSSTFSPSSDSLLSSTESSPRASPETPP
TTSSDSEGEQEDEEEIDVVSVEKRQLPAKRSEPGSPPAGHSRPPHSPLVLKRCHVSTHQH
NYAAPPSTRKDCPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHNVLERQRR
NELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSLQAEEQSLLSQKDLLRKRREQL
KHRVEQLRNSSACV
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgcccctcagcgtcagctttgccagcaggaactacgacctggactacgactcggtccag
ccctacttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccaccggcgcccagcgaggacatctggaagaaattcgagctgctgcccaccccgccc
ctgtccccgagccgccgctccgggctctgctcgccctcctacgtcgccgtggcgtccttc
tccccgggcggggacgacggcggtggtggcggcggcggcagcttctccacggccgaccag
ctggagatggtgaccgagcttctgggcggcgacatggtgaaccagagcttcatctgcgac
ccggacgacgagaccttcatcaagaacatcatcatccaagactgcatgtggagcggcttc
tcggccgccgccaagctggtctccgagaagctggcctcctaccaggctgcgcgcagggac
agcgccagcccgagccccgcccgcgggcccggctgctccacctccagcctgtacctgcag
gacctgagtgccgctgcgtcccagtgcatcgacccctcggtggtcttcccctacccgctc
agcgagagcggctcgcccaagccctgcgcctcgcccgactcctccaccttctccccgtcc
tcggactctctgctgtcctccaccgagtcctccccgcgggccagcccggagaccccgccc
actaccagcagcgactctgaaggagagcaagaggatgaggaagagatcgatgtggtgtcg
gtggagaagaggcagctccctgccaagaggtcggaacccgggtcgccccctgcgggccac
agcaggcccccccacagccctctagtcctcaagcggtgccacgtgtccacccatcagcac
aactacgctgcgcccccgtccacgaggaaggactgccccgctgccaagagggccaagctg
gacagtggcagggtcctgaaacagatcagcaacaaccgcaagtgtgccagccccaggtcc
tcagacacggaggagaacgacaagaggcggacacacaacgtgctggagcgccagaggaga
aatgagctgaaacggagcttttttgcgctgcgtgaccagatcccggagttggaaaacaat
gagaaggcccccaaggtggttatccttaaaaaagccacagcgtacatcctgtctctccaa
gccgaggagcagagcctcctttcccaaaaggacttgttgcggaagcggcgagaacagttg
aaacacagagttgagcagcttcggaactctagtgcttgtgtgtaa

DBGET integrated database retrieval system