KEGG   Heterocephalus glaber (naked mole rat): 101704771Help
Entry
101704771         CDS       T02812                                 

Gene name
Ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00590  Arachidonic acid metabolism
hgl01100  Metabolic pathways
hgl04064  NF-kappa B signaling pathway
hgl04370  VEGF signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04657  IL-17 signaling pathway
hgl04668  TNF signaling pathway
hgl04723  Retrograde endocannabinoid signaling
hgl04726  Serotonergic synapse
hgl04913  Ovarian steroidogenesis
hgl04921  Oxytocin signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl05140  Leishmaniasis
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05200  Pathways in cancer
hgl05204  Chemical carcinogenesis
hgl05206  MicroRNAs in cancer
hgl05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101704771 (Ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101704771 (Ptgs2)
   04064 NF-kappa B signaling pathway
    101704771 (Ptgs2)
   04668 TNF signaling pathway
    101704771 (Ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101704771 (Ptgs2)
   04657 IL-17 signaling pathway
    101704771 (Ptgs2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101704771 (Ptgs2)
   04913 Ovarian steroidogenesis
    101704771 (Ptgs2)
   04921 Oxytocin signaling pathway
    101704771 (Ptgs2)
  09156 Nervous system
   04726 Serotonergic synapse
    101704771 (Ptgs2)
   04723 Retrograde endocannabinoid signaling
    101704771 (Ptgs2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101704771 (Ptgs2)
   05206 MicroRNAs in cancer
    101704771 (Ptgs2)
   05204 Chemical carcinogenesis
    101704771 (Ptgs2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    101704771 (Ptgs2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    101704771 (Ptgs2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101704771 (Ptgs2)
   05165 Human papillomavirus infection
    101704771 (Ptgs2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    101704771 (Ptgs2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101704771 (Ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 101704771
NCBI-ProteinID: XP_004862837
UniProt: G5C6B9
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCQAASPCCSNPCQNRGECLSVGFDRYQCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNSIMRYVLTSRSHLIDSPPTYNSDY
GYRSWEAFSNLSYYTRVLPPVADDCPTPMGVKGKKELPDSNKVLEKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKSDPKRGPAFTTGLAHGVDLSHVYGETLDRQHKLRLFRDGKMKY
QIIDGEMYPPTVKDTQVQMIYPPHTPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFQIHDQEYNFQQFLYNNSMLVEHGLTQFVESFTKQIAGRV
AGGRNVPLAVQKVAKASIDHSRNMKYQSLNEYRKHFLLKPYASFEDLTGEKEMAAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPHYWKPSTFGGEV
GFKIINTASIQSLICTNVRGCPFTSFSIPDPELAKTVTINASASHSRLEDLNPTVLLKGH
SPEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctctgcgcagccctggcgctctgccaggcagccagtcct
tgctgttccaatccgtgtcagaaccgaggagagtgtctcagcgtgggattcgaccgctac
cagtgcgactgtacccggacagggttctacggtgaaaactgcaccacgcctgaatttcta
acaagaataaaattactgctgaagcccactccaaacacagtgcactacatactcacccac
ttcaagggagtctggaacattgtcaacaacattcccttcctgcgaaattcaatcatgaga
tacgtgctgacgtccagatcacatttgattgacagcccaccaacttacaactcggattat
ggctacagaagctgggaagccttctctaacctttcctactacacccgagtcctccctcct
gtggcggatgactgccccactcccatgggtgtgaaagggaagaaggagcttcctgattca
aacaaggttctggagaaagttcttctgagaagaaagttcatccctgaccctcaaggcacg
aatatgatgtttgccttcttcgcccagcacttcacccatcagtttttcaagtcagatccg
aaacgcggaccagctttcaccacaggactggcccacggggtggacttaagtcatgtttat
ggtgaaactctggatagacagcataaactgcgccttttcagggatggaaaaatgaaatat
cagataattgatggagagatgtaccctcccacagtcaaagatacccaggtacagatgatc
tacccaccccacacccctgagcacctgcgcttcgccgtgggccaggaggtcttcggccta
gtgcccggtctgatgatgtatgccaccatctggctgcgggaacacaacagagtgtgcgac
gtgcttaaacaggagcatccggagtgggatgatgagcgtctgttccagacaagcaggcta
atactgataggagaaacaattaagattgtgattgaagactacgtacagcacttgagcggt
taccacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccagtatcag
aaccgcattgcttctgagttcaacacactctaccactggcatccccttctgcctgacacc
tttcaaatccacgaccaggagtacaactttcaacagtttctctacaacaactctatgtta
gtggaacacggacttacccagtttgttgaatcattcaccaagcaaattgctggcagggtc
gctggtggcaggaatgttccacttgcagtacaaaaggtggcaaaggcttccattgaccac
agcagaaacatgaaataccaatctctgaatgagtaccgcaaacactttttgttgaagccc
tatgcctcatttgaagaccttacaggagagaaggaaatggctgcagagttggaagccctc
tacggtgacattgatgctgtggagctgtatcccgccctgctggtggaaaagcctcggcca
gacgctatcttcggtgagaccatggtggaaatgggagctccgttctccttgaaaggactc
atgggtaatcccatctgttccccacactactggaagccgagtacttttggaggagaagta
ggttttaagatcatcaacactgcttccatccagtctctcatctgcactaatgtgaggggt
tgtcctttcacatcgttcagtattccagatcctgagcttgccaaaacagtcaccattaac
gcaagtgcttcccactctagactggaggacctcaaccccacagtactgctaaaaggacat
tcaccggagctatag

DBGET integrated database retrieval system