KEGG   Heterocephalus glaber (naked mole rat): 101705227
Entry
101705227         CDS       T02812                                 

Gene name
Erbb2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04020  Calcium signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04530  Tight junction
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05215  Prostate cancer
hgl05219  Bladder cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101705227 (Erbb2)
   04012 ErbB signaling pathway
    101705227 (Erbb2)
   04066 HIF-1 signaling pathway
    101705227 (Erbb2)
   04020 Calcium signaling pathway
    101705227 (Erbb2)
   04151 PI3K-Akt signaling pathway
    101705227 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101705227 (Erbb2)
   04520 Adherens junction
    101705227 (Erbb2)
   04530 Tight junction
    101705227 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101705227 (Erbb2)
   05206 MicroRNAs in cancer
    101705227 (Erbb2)
   05205 Proteoglycans in cancer
    101705227 (Erbb2)
   05230 Central carbon metabolism in cancer
    101705227 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101705227 (Erbb2)
   05226 Gastric cancer
    101705227 (Erbb2)
   05219 Bladder cancer
    101705227 (Erbb2)
   05215 Prostate cancer
    101705227 (Erbb2)
   05213 Endometrial cancer
    101705227 (Erbb2)
   05224 Breast cancer
    101705227 (Erbb2)
   05223 Non-small cell lung cancer
    101705227 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101705227 (Erbb2)
   01524 Platinum drug resistance
    101705227 (Erbb2)
   01522 Endocrine resistance
    101705227 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101705227 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101705227 (Erbb2)
   04090 CD molecules [BR:hgl04090]
    101705227 (Erbb2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101705227 (Erbb2)
Protein kinases [BR:hgl01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101705227 (Erbb2)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101705227 (Erbb2)
CD molecules [BR:hgl04090]
 Proteins
  101705227 (Erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH DUF3357 Kinase-like RIFIN EphA2_TM GAPT
Other DBs
NCBI-GeneID: 101705227
NCBI-ProteinID: XP_004859544
LinkDB
Position
Un
AA seq 1253 aa
MELAAWCRCGLLLALLPAAAAGTQVCTGTDMKLQLPTSPETHLEMLRYLYQGCQVVQGNL
ELTYLPADASLSFLQDIQEVQGYLLIAHNQVRQIPLQRLRIVRGTQLFEDSYALAVLDNR
DPVDSTTLAPGAAPGGLRELQLRSLTEILKGGVLIQRNPQLCHQDTVLWRDIFHKNSRLA
PVQVDTNRSRACPPCSPACRAPYCWGGSTQDCQSLTRTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESVPNPEGRYTFGASCVTTCP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLRASRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDPASNTAPLQPTQLSVFETLEEITGYLYISAWPETMQ
DLGVFQNLRVIRGRILHNGAYSLTLQGLGIRWLGLRSLRELGSGLALVHHNPRLCFVHTV
PWDQLFRNPHQGLLHSGNRPEAECAAEDLACNSLCAHGHCWGPGPTQCVNCSHFLRGQEC
VEQCHILQGLPREYVSDRHCLRCHPECQPQNASVTCFGLEADQCVACAHYKDPPLCVARC
PSGVKPDLSYMPIWKFPDEEGTCQLCPINCTHSCVDLDDRGCPAEQRASPVTSIIAAVVG
VLLFVVMCVVIGIVLKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGSASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGTTGTAHRRHRSSSTRSGGGELTLRLEPPEEEPPRSPLASSEG
AGSDVFEGDPGMGTARGLQSLPSHDPSPLQRYSEDPTVPLAPETDGYVTPLTCSPQPEYV
NQPELQLKPPLPLEGPLSPVPPAGATLERPKTLSSGKNGVVKDVFAFGGAVENPEYLAPR
GSAQPHPPPTFSPAFDNLYYWDQDPPEQGSPPGTFEGTPTAENPEYLGLDVPV
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgcgggctcctcctcgccctgctgcccgccgctgcc
gcgggcacccaagtgtgcacaggcaccgacatgaagctgcagctgcccaccagccccgag
acccacctggagatgctccgctacctctaccagggctgccaggtggtgcaggggaacctg
gagctcacctacctgcctgccgatgccagcctgtccttcctgcaggacattcaggaggtg
cagggctacctgcttatcgcacacaaccaagtgaggcagatcccactgcagaggctgcgg
attgtgcggggcacccagctcttcgaggacagctacgccttggctgtgctggacaacagg
gaccctgtggacagcaccaccctggccccgggggctgccccaggaggacttcgggagctg
cagctccggagtctcacagagatcctgaagggaggcgtcctgatccagcggaacccccag
ctctgccaccaggacaccgttctgtggagggacatcttccataagaacagccgtctggcc
cccgtgcaggtggacaccaaccgctcgcgggcctgcccaccctgctccccagcctgcaga
gccccctactgctgggggggaagcacccaggactgtcagagcctgacgcgcacggtgtgt
gctagtggctgtgcccgctgcaagggcccgcagcccaccgactgctgtcacgagcagtgt
gccgcaggctgcacgggccccaagcactccgactgcctggcctgcctgcacttcaaccac
agtggcatttgtgagctgcactgcccggccctggtcacctacaacacggacacctttgag
tccgtgcccaaccccgagggccgctacaccttcggcgccagctgtgtgaccacctgtccc
tacaactacctctccacggacgtgggctcctgcaccctggtctgtccgctgaacaaccag
gaggtgacagcagaggatggaacccagcgctgtgagaagtgcagcaagccgtgcgcccga
gtgtgctacgggctgggcatggagcaccttcgggctagcagggccgtcaccagcgccaac
atccaggagttcgccggctgcaagaagatcttcgggagcctggcgttcttgcccgagagc
tttgagggggaccccgcctccaacacagcgcccctgcagcccacgcagctcagcgtgttc
gagaccctggaggagatcacaggttacctgtacatctccgcatggccagaaaccatgcag
gacctaggtgtcttccagaatctgcgagtcatccgggggcgcattctgcacaacggtgcc
tactcgctcaccctacaagggctgggcatccgctggctggggctgcgctcgctgagggag
ctgggcagcgggctggccctggtccaccacaatccccgcctgtgtttcgtgcacacggtg
ccctgggaccagctcttccggaacccgcaccagggcctgctccacagtggcaaccggcca
gaagctgagtgcgctgcggaggacctggcctgcaactcgctgtgtgcccacgggcactgc
tgggggccgggccccacccagtgtgtcaactgcagccacttcctccggggccaggagtgt
gtggagcagtgccacatcctgcaggggctgccccgggagtatgtgagcgacaggcattgc
ctgcggtgccaccctgagtgccagccccagaatgcctccgtgacctgctttggattggag
gccgaccagtgcgtagcctgtgcccactacaaggaccctcctctgtgtgtggcccgctgc
cccagtggcgtgaagcccgacctctcctacatgcccatctggaagttcccggatgaggag
ggcacgtgccagctgtgcccaatcaactgcacgcactcctgcgtggacctggatgacagg
ggctgcccggcggagcagagagccagccctgtgacgtccatcatcgcggccgtggtgggc
gtcctgctcttcgtggtcatgtgtgtggtcatcggcatcgtcctcaagcggaggcggcag
aagatccggaagtacaccatgcggaggctgctgcaggagaccgagctggtggagccgctc
acgcccagcggggccatgcccaaccaggcacagatgaggatcctgaaggagacggagctg
aggaaggtgaaggtgcttggatccggagctttcggcaccgtctacaagggcatctggatc
cccgatggggagaacgtgaagatccctgtggctatcaaagtgttgcgggaaaacacatcc
cccaaggccaacaaggaaatcttggacgaagcctacgtgatggctggcgtgggctccccg
tacgtgtcccgcctccttggcatctgcctgacgtccaccgtgcagctggtgacgcagctc
atgccctacggctgcctcctggaccacgtccgcgagcaccgcgggcgcctgggctcccag
gacctgctcaactggtgcgtgcagatcgccaagggcatgagctacctggaggacgtgcgc
ttggtgcacagggacctggctgcccgcaatgtgttggtcaagagccccaatcacgtgaag
atcacagacttcgggctggcgcggctgctggacatcgatgagacggagtaccacgcggac
gggggcaaggtccctatcaagtggatggcgctggagtccatcctgcgccgtcggttcacc
caccagagcgacgtgtggagctacggggtgaccgtgtgggagctgatgacttttggggcc
aaaccctatgacgggataccagcccgagagatccccgacctgctggagaagggggagcgg
ctgccccagcccccgatctgcaccatcgacgtctacatgatcatggtcaaatgttggatg
atcgactccgagtgtcggccgcgattccgggagctggtggccgaattctcccggatggcc
cgggacccccagcgttttgtggtcatccagaatgaggacctgggctctgccagcccgctg
gacagcaccttctaccgctcgctgctggaggatgatgacatgggggacctggtggacgct
gaggagtacctggtgccccagcagggcttcttctgcccggaccccgccccggggaccaca
ggcacagcccaccgcaggcaccgcagctcctccacccggagtggtggtggggagctgacg
ctgcggctggagccccccgaagaggagcccccccggtccccgctggcctcctcagaaggg
gccggttccgatgtgtttgagggcgaccccggaatggggacagccagggggctccagagc
ctcccctcacacgaccccagccccctgcagcggtacagcgaggaccccacggtccccctg
gccccagagactgacggctacgtcaccccactgacctgcagcccccagcctgaatatgtc
aaccagccagagctccagctgaaaccccccttgcccttagagggtcctctgtcccctgta
ccacctgctggtgccactctggaaaggcccaaaactctctcctctgggaagaatggggtt
gtcaaggacgtttttgcctttgggggtgctgtggagaaccctgagtacttggcaccccga
ggaagtgcccagccccaccctccgcccacctttagcccggcctttgacaacctctattac
tgggaccaggacccaccagagcaggggtctccccctggcacctttgaagggactcctacg
gcagagaaccctgagtacctgggtctagacgtgcccgtgtga

DBGET integrated database retrieval system