KEGG   Heterocephalus glaber (naked mole rat): 101706410Help
Entry
101706410         CDS       T02812                                 

Gene name
Hk3
Definition
(RefSeq) hexokinase 3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00010  Glycolysis / Gluconeogenesis
hgl00051  Fructose and mannose metabolism
hgl00052  Galactose metabolism
hgl00500  Starch and sucrose metabolism
hgl00520  Amino sugar and nucleotide sugar metabolism
hgl00524  Neomycin, kanamycin and gentamicin biosynthesis
hgl01100  Metabolic pathways
hgl01200  Carbon metabolism
hgl04066  HIF-1 signaling pathway
hgl04910  Insulin signaling pathway
hgl04930  Type II diabetes mellitus
hgl04973  Carbohydrate digestion and absorption
hgl05230  Central carbon metabolism in cancer
Module
hgl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hgl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101706410 (Hk3)
   00051 Fructose and mannose metabolism
    101706410 (Hk3)
   00052 Galactose metabolism
    101706410 (Hk3)
   00500 Starch and sucrose metabolism
    101706410 (Hk3)
   00520 Amino sugar and nucleotide sugar metabolism
    101706410 (Hk3)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101706410 (Hk3)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    101706410 (Hk3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101706410 (Hk3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    101706410 (Hk3)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101706410 (Hk3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101706410 (Hk3)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101706410 (Hk3)
Membrane trafficking [BR:hgl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101706410 (Hk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101706410
NCBI-ProteinID: XP_004836371
LinkDB All DBs
Position
Un
AA seq 969 aa AA seqDB search
MLHLPGGQTPLWNHMDSVEPAGLQPGKRASGCPQKGLFQPSDSSELVQECLQQFKVTRTQ
LQQIQASLLDSMEQALTGEASPAPGVRMLPTYVGSTPHGNEQGNFVVLELGASGASLRVL
WVTLTGIKGQRVEPKSQEFVIPQEVVLGTGQQLFDFAAHCLFEFLGAHSVGNQGLQLGFS
FSFPCHQTGLDRVRWRGNRDSGWRGNAAPMKAFGSVTQLFCPQSTLISWTKGFRCSGVEG
QDVVQLLRDAIQRQGAYSIDVVAVVNDTVGTMMGCEPGVGSCEVGLVIDTGTNVCYMEEA
RHVAMLDEDRGRTCISVEWGSFNDDGALGPVLTTFDHALDHASLNPGAQRFEKMIGGLYL
GELVRLVLAHLAQHRVLFGGYTSPALLSQGSILLEHVAEMEDPTTGAARVHTILQELGLS
PEASDAELVQRVCAAVCSRAAQLCAAALAAILSRLQRSREQQILQVTVATGGQVLERHPR
FRGILQETVKLLASECNVSFIPSVDGGGRGVAMVTAVAARLAAHRRLLEETLAPFRLSHE
QLATVQTQMREAMAKGLRREASSLRMLPTYVRATPDGSERGDFLALDLGGTNFRVLLVRV
AEGGVQIVNQVYSIPECVAQGSGQQLFDHIVDCIVDFQQKQGLRGQSLPLGFTFSFPCKQ
LGLDQGILLNWTKGFNASGCEGQDVVYLLREAIKRRQAVELNVVAIVNDTVGTMMSCGYE
DPRCEMGLIVGTGTNACYMEELQNVAGVAGDSGHMCINMEWGAFGDDGSLGMLSTCFDVR
VDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFQGQQTQRLQTRDIFKTKFLS
EIESDSLALRQVRAILEDLGLSLTSDDALIVLEVCQAVSRRAAQLCGAGVAAVVEKIREN
RGLEELTVSVGVDGTLYKVHPHFANLVAATVRELAPRCVVTFLQSEDGSGKGAALVTAVA
CRLAQMACV
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatctcccaggtggccagactccattgtggaaccatatggactccgtagagcct
gccgggttgcaacctgggaaaagagcttcaggctgtccccagaagggcttatttcagccc
tcagacagctcagagctggtacaggagtgtctgcagcaattcaaggtgacaaggacacag
ctacagcagatccaagccagcctcttagactccatggagcaggccctgacaggagaggcc
agccctgcccctggtgtccggatgctgcctacatatgtggggtctacccctcatggcaat
gagcaaggaaacttcgtggtgctggagctgggggcttcaggagcatcactgcgtgtcttg
tgggtgactctgacgggcatcaaggggcagagggtggagcccaagagccaggagtttgtg
atcccccaggaggtggtactgggcactggccagcagctctttgactttgctgctcactgc
ctttttgagttcctgggtgcacactctgtggggaatcagggtctgcagcttggattcagc
ttctccttcccttgtcaccagacgggactggacagggtgaggtggaggggcaatagggac
agtgggtggagagggaatgcagcccctatgaaggcctttggaagcgtaacccagcttttt
tgcccccagagcaccctcatttcttggaccaaaggttttaggtgcagtggtgtagaaggc
caggatgtggtccaattgctgagagatgccattcagaggcagggggcctacagcattgat
gtggttgctgtggtgaatgatacagtgggcacgatgatgggctgcgagccaggtgttggg
tcatgtgaagttggccttgtcatagacactggcaccaatgtgtgttacatggaggaggca
cggcatgtggcaatgctagacgaggaccggggccgcacctgcatcagcgttgaatggggc
tccttcaatgatgatggggctctggggccagtgctgaccacctttgaccatgccctggac
catgcatccctgaatcctggtgcccagaggtttgagaagatgatcgggggcttgtacctg
ggggaactggtgcggctggtgctggcccatttggcccagcacagggtcctgtttggtggc
tacacctctcctgctttgctgagccaaggcagcatcctcctggaacacgtggctgagatg
gaggaccccaccactggggcagcccgtgtccacacaatcctgcaggagttgggcctgagc
ccggaggcctcagatgctgagcttgtgcagcgcgtctgtgcagccgtgtgctctcgggct
gcccagctctgtgctgctgccctggccgccatcctgtcccgcctccagcgcagccgggag
cagcagatactccaggtcaccgtggctactggaggccaagtgcttgaacggcaccccagg
ttccgcggcatcctacaggagacagtgaagctcttggcttcagaatgtaatgtctccttc
atcccttctgtggatggaggtggccggggtgtggcaatggtgacagctgtggctgcccgc
ctggctgcccaccgacgactgctggaggagaccctagcaccattccggttgagccatgag
cagctggcaacagtgcagacacagatgcgggaggccatggccaagggcctgcgaagggag
gcctcctctctccgaatgctgcccacatacgtacgggctacacctgatggcagtgaacga
ggggacttcctggctttggaccttgggggcaccaactttcgggtcctcctggtgcgtgtg
gccgagggaggtgtgcagatcgtcaaccaggtctactccatccctgagtgtgtggctcag
gggtctgggcagcagcttttcgaccacatcgtggactgcattgtggacttccagcagaag
cagggcctgaggggacagagcctccccctgggtttcaccttttccttcccatgcaagcag
cttggcctggaccagggcatcctcctgaactggactaagggtttcaacgcatcaggttgc
gagggccaggatgttgtgtatctgttgcgggaagccatcaagcgtagacaggcagtggag
ctgaatgtggttgccattgtcaatgacacagttgggaccatgatgtcctgtggctatgag
gatccccgttgcgagatgggcctcattgttggaactggtaccaatgcctgctacatggaa
gagctccagaatgtggcaggtgtggcgggggactcaggccacatgtgcatcaacatggag
tggggtgcctttggggatgatggctctttgggcatgctcagcacctgttttgatgtgagg
gtggaccaggcatccatcaatcctggcaagcagaggtttgagaagatgatcagtgggatg
tacttgggagagattgtccgccacatcctcttacatttgaccagccttggagttctcttc
cagggccagcagacccagcgccttcagactagggacatcttcaagaccaagtttctctct
gagattgaaagcgacagcctggccctgcgacaggtccgagccatcctggaggatctgggg
ctgtccctgacctcggatgatgccctgatagtcctagaggtgtgccaggctgtgtcccgg
agggctgcccaactctgcggggcaggtgtggctgctgttgttgagaagatccgggagaac
cggggcctggaggagctgacggtgtctgtgggggtggatgggaccctctacaaggtgcac
cctcactttgccaatcttgtggctgccacagtacgggaactggcccctcgctgtgtggtc
accttcttgcagtcagaagatgggtctggcaaaggtgcagctttggtcactgctgtcgcc
tgtcgccttgctcagatggcctgtgtctga

DBGET integrated database retrieval system