KEGG   Heterocephalus glaber (naked mole rat): 101706414
Entry
101706414         CDS       T02812                                 

Gene name
Il4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl05140  Leishmaniasis
hgl05200  Pathways in cancer
hgl05310  Asthma
hgl05320  Autoimmune thyroid disease
hgl05321  Inflammatory bowel disease
hgl05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101706414 (Il4)
   04151 PI3K-Akt signaling pathway
    101706414 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101706414 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101706414 (Il4)
   04660 T cell receptor signaling pathway
    101706414 (Il4)
   04658 Th1 and Th2 cell differentiation
    101706414 (Il4)
   04659 Th17 cell differentiation
    101706414 (Il4)
   04657 IL-17 signaling pathway
    101706414 (Il4)
   04664 Fc epsilon RI signaling pathway
    101706414 (Il4)
   04672 Intestinal immune network for IgA production
    101706414 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101706414 (Il4)
  09163 Immune disease
   05310 Asthma
    101706414 (Il4)
   05320 Autoimmune thyroid disease
    101706414 (Il4)
   05321 Inflammatory bowel disease
    101706414 (Il4)
   05330 Allograft rejection
    101706414 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101706414 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101706414 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101706414 (Il4)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101706414 (Il4)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Haparin
  Cytokines
   101706414 (Il4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 101706414
NCBI-ProteinID: XP_012932792
UniProt: G5ASQ0
LinkDB
Position
Un
AA seq 140 aa
MGLVPQLTVTLFCLLACTGTFVRGCNDALQEIINDLNVLSSQKTPCAELAAADVFAAPKD
TAEKLCQAVTVLHRTSYLGVGLSCLNRHRESVFLVLLKKVYRNLRSMVQPNCSVSELKQT
TLKDFLENLKTILKKKYSEC
NT seq 423 nt   +upstreamnt  +downstreamnt
atgggtcttgtcccccagctgacagtcaccctgttctgcctcctagcatgtaccggcacc
ttcgtccgtggctgcaacgatgccttacaagaaatcatcaatgatctgaatgtgctctca
agccaaaagactccatgtgctgagctggctgctgcagacgtcttcgctgcccccaaggac
acagccgagaagctgtgccaggctgtgacagtgctgcatcgcacatcctacctcggggtg
gggctttcgtgcctgaacagacacagagaatcagtctttctggttctcctgaagaaggtc
tacaggaacctcaggagcatggttcagccgaactgttctgtgagtgaactcaagcagacg
acgttgaaagacttcttggaaaacctaaaaacgatcctgaaaaagaaatactcagagtgt
tga

DBGET integrated database retrieval system