KEGG   Heterocephalus glaber (naked mole rat): 101706449Help
Entry
101706449         CDS       T02812                                 

Gene name
Aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00010  Glycolysis / Gluconeogenesis
hgl00053  Ascorbate and aldarate metabolism
hgl00071  Fatty acid degradation
hgl00280  Valine, leucine and isoleucine degradation
hgl00310  Lysine degradation
hgl00330  Arginine and proline metabolism
hgl00340  Histidine metabolism
hgl00380  Tryptophan metabolism
hgl00410  beta-Alanine metabolism
hgl00561  Glycerolipid metabolism
hgl00620  Pyruvate metabolism
hgl01100  Metabolic pathways
Module
hgl_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101706449 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    101706449 (Aldh2)
   00620 Pyruvate metabolism
    101706449 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101706449 (Aldh2)
   00561 Glycerolipid metabolism
    101706449 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101706449 (Aldh2)
   00310 Lysine degradation
    101706449 (Aldh2)
   00330 Arginine and proline metabolism
    101706449 (Aldh2)
   00340 Histidine metabolism
    101706449 (Aldh2)
   00380 Tryptophan metabolism
    101706449 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101706449 (Aldh2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101706449 (Aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101706449
NCBI-ProteinID: XP_004843838
UniProt: G5AKU7
LinkDB All DBs
Position
Un
AA seq 521 aa AA seqDB search
MLRAAAVAAADLGPRLGCRLLSVGAAQAIPTPNQQPEVFYNQIFINNEWHDAVSKKTFPT
VNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRINASERGRLLYRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCIRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVASLIKEAGFPPGVVN
IVPGFGPTAGAAIASHEDVDKVAFTGSTEVGQLIQVAAGSSNLKKVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYEEFVERSVARAKARVVGNPFDSQT
EQGPQVDETQFKKILGYIKSGKEDGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDIDKANYVSQALQAGTVWVNCYNVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgccgcggtcgccgccgccgaccttgggccccgccttggctgccgcttg
ttgtccgttggggccgcccaggcaatcccgacccccaaccagcagcctgaggtcttctat
aaccagatcttcataaacaatgaatggcacgatgcagtcagcaagaaaacgttccccaca
gtcaacccatccactggggaggtcatctgtcaggtagcagaagggaacaaggaagacgtg
gacaaggccgtgaaggctgcccgggccgccttccagctgggctcgccctggcgccgcata
aatgcatcagaaaggggccggctgctgtaccgcctggctgatctcatcgagcgggaccgg
acctatctggcagccttggagaccctggacaatgggaagccctatgtcatctcctacctg
gtggacttggacatggtcttgaaatgcatccggtattatgccggctgggcagataagtac
catgggaaaaccattccaattgatggagacttcttcagctacactcgccatgagcccgtg
ggggtgtgtgggcagatcattccgtggaacttcccactcctgatgcaagcatggaaactg
ggcccagccttggcgactggaaatgtggttgtgatgaaggttgctgagcagacgcctctc
actgcactctatgtggccagcctaatcaaggaggctggcttccctcctggtgtggtcaat
attgttcctggatttggccccacggctggggctgccatcgcctcccatgaagacgtggat
aaagtggcattcacagggtccaccgaggttggccaactcatccaggtggctgcggggagc
agcaacctcaagaaagtgacactggagctggggggaaagagccccaacatcatcatgtcg
gatgccgatatggactgggccgtggaacaggcccactttgccctgttcttcaaccagggc
cagtgttgttgtgccggctcccggacctttgtgcaggagaacgtttatgaggagtttgtg
gagcgaagtgttgcccgggccaaggctcgggtagttgggaacccctttgacagccagaca
gagcaggggccgcaggtagatgaaactcagttcaagaagatccttggctacataaaatcc
gggaaggaagacggtgcaaagctgctgtgtggtggaggggccgctgctgaccgtggctat
ttcatccagcccactgtgtttggagacgtgcaagatggcatgaccatcgcgaaggaggag
atcttcgggccagtgatgcagatcctgaagttcaagaccatcgaggaagttgttgggaga
gccaacaattccaagtatgggctggctgcagctgtcttcacaaaggacatagacaaggcc
aattatgtgtcccaagccctccaagccggcaccgtgtgggtcaattgctacaatgtgttt
ggggcccagtccccctttggtggttataagatgtctgggagtggccgggagctgggggag
tatggcctgcaagcgtacaccgaagtgaagaccgtcacagtcaaagttcctcagaagaac
tcataa

DBGET integrated database retrieval system