KEGG   Heterocephalus glaber (naked mole rat): 101707295
Entry
101707295         CDS       T02812                                 

Gene name
Stat2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04062  Chemokine signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04621  NOD-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101707295 (Stat2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101707295 (Stat2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101707295 (Stat2)
   04625 C-type lectin receptor signaling pathway
    101707295 (Stat2)
   04062 Chemokine signaling pathway
    101707295 (Stat2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101707295 (Stat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101707295 (Stat2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101707295 (Stat2)
   05160 Hepatitis C
    101707295 (Stat2)
   05171 Coronavirus disease - COVID-19
    101707295 (Stat2)
   05164 Influenza A
    101707295 (Stat2)
   05162 Measles
    101707295 (Stat2)
   05168 Herpes simplex virus 1 infection
    101707295 (Stat2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101707295 (Stat2)
   05169 Epstein-Barr virus infection
    101707295 (Stat2)
   05165 Human papillomavirus infection
    101707295 (Stat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101707295 (Stat2)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101707295 (Stat2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2
Other DBs
NCBI-GeneID: 101707295
NCBI-ProteinID: XP_004861354
LinkDB
Position
Un
AA seq 841 aa
MAQWERLQNIDSPFQDQLDQLYLHSLLPVDIRQHLAVWIEDQNWKEAALGNDNSKANMLF
FQFVDQLNNECGRCSQDPECLLLQHNLRKFCRDIQALPQGSTQLAEMMFNLLLEEKRILN
QAQRAEVEQGNTTLEVPVESQQSEIESRILDLRAMMEMLVKSIRQLKDLHDVFSFRYMIL
EKGKTSSSDPNQSKQLQLVQETLNELDKRRKEVLDATKALLGRLTTLVELLIPKLNEWKA
QQQKACIGAPLKLGLEELEKWFTAGAELLFHLRQLLKQLKELSDMVHYEGDHLKEGVELL
NAQVTELLQYLLDRAFVVEKQPCMPQTPHRPLIIKTGSKFTVRTRLLVRLQEGNEPLTAE
ISIDKNPPQLHSFRKFNIRTSNQKTLTPEKGQRQGLIWDFGFLMLLEQRTGGSGKGNSKG
PLAVTEELHIINFTVRYMYQGLQLDLKTDTLPVVIISNMNQLSIAWASVLWFNLLSPTPQ
NQQFFSSPAMAPWSLLGPALSWQFSSYVGQGLNQEQLGMLKEKLFGKNSKMENSLSWANF
SKRESPPGKIPFWTWLDKILELVHDYLKDLWNDGHIMGFVSRSQERRLLKRTISGTFLLR
FSESSEGGITCSWVEHQDDDKVVIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPL
RFLYPRTPRDEAFGRYYQEKVNLEEQRKYLKHKLIVVSNRQVDELQQPLELKQEPELESL
ELEQRLMPKLELGIGLELEPLLETRLNLGSELEPVLESMLEPGLDLEPTQFMASQPVPDS
DLPHDLQHLSTKDMEIFRNTVNIEDIMPNGDPLLAGQNVMDEPYMSCPSHFCTDGPLNPD
C
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggctcagtgggagagactgcagaacattgatagcccgtttcaggaccagctggaccaa
ctgtacttacacagcctccttccagtggacatccgacagcacttggctgtctggattgaa
gaccagaactggaaggaagctgcactaggcaatgataattccaaggccaacatgctattc
ttccagtttgtggaccaactgaacaatgaatgtggccgctgcagccaagaccctgagtgc
ttactgttacagcacaacctgcggaaattctgccgggacattcaggccttaccccagggc
tctacccagttggctgagatgatgtttaatctccttctggaagaaaaaagaattctgaac
caggctcagagggctgaagtggaacaaggaaatacaactcttgaagtacccgtggagagc
cagcagtctgagattgaatcccggatcctggatttaagggctatgatggagatgctggtg
aagtccatcagacaactgaaagaccttcacgatgtcttcagcttccgatacatgatactc
gaaaaagggaagacatcctcctcagacccgaatcaaagcaaacagctacagcttgtgcaa
gaaactcttaatgaactggacaagaggagaaaggaggtgctggatgccaccaaagcactg
ctaggccgattgaccaccctcgttgagctactgattccaaagttgaatgagtggaaagcc
cagcagcaaaaagcctgcattggagcaccgctaaagcttgggttggaagagctggagaag
tggttcacagctggagcagagctgttgtttcacctgaggcagctgctgaaacagctgaag
gaactgagcgacatggttcactatgaaggtgaccatctgaaggaaggggtagagctgctg
aatgcccaggtcacagagctgctacagtatctgctggacagggcctttgtggtggaaaaa
cagccctgcatgccacagacaccccatcggccccttatcataaagactgggagcaagttc
actgtccgaaccaggctgctggtaagactccaggaaggcaacgagccactaacggcagag
atctccattgacaagaatcctcctcaattacatagctttcgaaagttcaacatccggacc
tcaaaccagaaaactttgacccctgagaaggggcagagacaaggcttaatttgggacttt
ggcttcctgatgcttttggagcaacgtacaggtggttcaggaaagggcaacagtaagggt
ccgctggctgtgacagaggaactgcacatcatcaatttcacagtcagatacatgtaccag
ggtctgcagctggatctgaaaacggacactctccctgtggtgattatttctaacatgaac
caactctccattgcctgggcctcagttctctggttcaatctgctcagcccaaccccccag
aaccagcagttcttctccagccccgctatggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctacgttggccaaggcctcaaccaggagcagctgggcatgctg
aaggaaaagctgttcgggaagaactctaagatggagaattcgttgtcctgggctaacttc
agtaagcgagagagcccccctggcaagataccgttctggacatggctggacaaaattctg
gaactggtacatgactacctgaaggatctgtggaatgatgggcacatcatgggctttgtg
agccggagccaggagcgtcggctgctgaagagaaccatctctggcacctttctgctccgg
ttcagtgaatcatcggaaggaggcattacctgctcctgggtggagcaccaggatgatgat
aaggtggtcatctattctgtgcagccgtataccaaggaggtgctgcagtccctccccctg
accgaaatcatccgccactaccagctgctcaccgaggagaacataccagagaacccgctg
cgcttcctctatccccgaacgccccgcgatgaggcttttgggcgctactaccaggaaaaa
gttaatcttgaggaacagaggaaatacctgaaacataagctcattgtggtctctaacagg
caggtggatgagctgcagcaacctctggagcttaaacaggagccagaactggagtcctta
gagctggagcaaaggctgatgccaaagctagagctggggattggcctggagttagagcca
ctgctggagacaaggctgaatctgggctcagagctggagcccgtgttggagtctatgctg
gagccagggctggacctggagcccacacagttcatggcatcacagccagtgccagattca
gatttgcctcatgatctgcaacacttaagcactaaagacatggaaatcttcaggaacact
gtgaatattgaagatatcatgccgaatggtgacccactgttggctggccagaacgtcatg
gatgagccttacatgtcctgccccagccatttctgcacagatggacccttgaatcctgac
tgctag

KEGG   Heterocephalus glaber (naked mole rat): 101718558
Entry
101718558         CDS       T02812                                 

Gene name
Stat4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04217  Necroptosis
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl05161  Hepatitis B
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101718558 (Stat4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101718558 (Stat4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101718558 (Stat4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718558 (Stat4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101718558 (Stat4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101718558 (Stat4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101718558 (Stat4)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101718558 (Stat4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 STAT1_TAZ2bind NPV_P10
Other DBs
NCBI-GeneID: 101718558
NCBI-ProteinID: XP_004869015
UniProt: A0A0P6J7T0
LinkDB
Position
Un
AA seq 748 aa
MAQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILATAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNNALMNQEVLTLQEMLNSLDFKRKEALSKMAQIVNETDLLMGSMLLEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYDGDPVPMQRTHL
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPMILKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGNKGNEGSH
VVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTSESQNL
VFFNNPPPATLSQLLEVLSWQFSSYVGRGLNSDQLNMLAEKLTVQSSYSDGQLTWSKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDQSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTEKGDKGYVPSVFIPVSTIRSDSAEPQSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYPAE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggctcagtggaatcaagtccaacagttagaaatcaagttcttggagcaagtagatcaa
ttctatgatgacaactttccgatggaaatccgacatctgctggcccagtggattgaaaat
caagactgggaggcagcttctaacaatgaaaccatggcgacaattctgcttcaaaacttg
ttaatacaactggatgaacaattaggtcgtgtttccaaggagaaaaacctgctcttgata
cacaatctaaaaagaattaggaaagtccttcaggggaaatttcatggaaatccaatgcat
gtagctgtggttatctccaattgtttaagggaagagaggagaatattggctacggccaac
atgcctgtccagggacccttggagaaatccttacagagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaacagcgtgcagatgacagaacaagac
accaaatacttagaagacctgcaagatgaatttgactacagatataaaacaattcagaca
atggatcagggagacaagaataatgccctgatgaatcaggaagttttgacgctgcaagaa
atgctcaacagcctagacttcaagagaaaggaggccctcagtaagatggcacagatagtg
aatgagacagacttgctgatgggcagcatgctgctagaggagctgcaggactggaagcgg
cggcagcaaatcgcctgcatcgggggtccgctccacaatgggctcgaccagcttcagaac
tgctttaccctactggcagaaagtcttttccaactcagaaggcagctggagaaattggag
gagcaatctaccaaaatgacatatgatggcgatcctgtacccatgcaaagaactcacctg
ctggaaagagtcaccttcttgatctacaaccttttcaagaactcatttgtggttgagcga
cagccatgtatgcccacccaccctcagagaccgatgatactgaaaaccctcattcagttc
acagtgaagctcagactgctaataaaattgccagaattaaactatcaggtgaaggttaaa
gcatcaattgacaagaatgtttcaactctaagcaatcgaagatttgtcctttgtggaaca
catgtcaaagccatgtccattgaagaatcctccaatggaagtctctccgtagaatttaga
catttgcaaccaaaagaaatgaagtccagtgctggaaacaaaggaaatgagggctctcac
gtggtgaccgaagagcttcactccataacctttgagacacagatctgcctgtatggcctg
accatcgatttggagaccagttcattacctgtggtgatgatttccaatgtcagtcagcta
cctaatgcttgggcgtccatcatttggtacaacgtgtcaaccagtgagtcccagaacttg
gttttctttaacaatcccccacctgccaccctgagccagctcttggaggtcttgagctgg
cagttttcttcctatgtcggccgtggccttaattcggatcaactcaacatgctggcagag
aagctcacagtgcagtctagctacagtgatggacaactcacctggtccaagttctgcaag
gagcacttacctggtaaatcatttaccttctggacatggcttgaagcaatattggatcta
atcaaaaaacacattcttcccctttggattgatgggtacatcatgggctttgttagcaaa
gaaaaggagcggctgctgctgaaggataaaatgcccgggacatttttactaagattcagt
gagagccatctgggagggataaccttcacctgggtggaccaatctgagaatggagaagtg
agattccactccgtggaaccctacaacaaaggcaggttgtctgctctgccattcgctgac
atccttcgagactacaaggtcattatggctgagaacatccccgaaaaccctctgaagtac
ctgtaccctgacatccccaaagacaaggccttcggtaaacactacagctcccagccatgc
gaagtttcaagaccaacagaaaagggagacaaaggttatgttccttcagtctttatccct
gtttccacaatccgaagtgattctgctgagccacagtcgccctccgacctcctccccatg
tctccaagtgtatatgcagtgctgagagaaaacctgagtcccacaaccatcgaaactgcc
atgaagtcgccgtatcctgctgagtga

KEGG   Heterocephalus glaber (naked mole rat): 101718902
Entry
101718902         CDS       T02812                                 

Gene name
Stat1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04062  Chemokine signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05140  Leishmaniasis
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05212  Pancreatic cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101718902 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101718902 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101718902 (Stat1)
   04621 NOD-like receptor signaling pathway
    101718902 (Stat1)
   04625 C-type lectin receptor signaling pathway
    101718902 (Stat1)
   04658 Th1 and Th2 cell differentiation
    101718902 (Stat1)
   04659 Th17 cell differentiation
    101718902 (Stat1)
   04062 Chemokine signaling pathway
    101718902 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101718902 (Stat1)
   04935 Growth hormone synthesis, secretion and action
    101718902 (Stat1)
   04919 Thyroid hormone signaling pathway
    101718902 (Stat1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101718902 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718902 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101718902 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101718902 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101718902 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101718902 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101718902 (Stat1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101718902 (Stat1)
   05160 Hepatitis C
    101718902 (Stat1)
   05171 Coronavirus disease - COVID-19
    101718902 (Stat1)
   05164 Influenza A
    101718902 (Stat1)
   05162 Measles
    101718902 (Stat1)
   05168 Herpes simplex virus 1 infection
    101718902 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101718902 (Stat1)
   05169 Epstein-Barr virus infection
    101718902 (Stat1)
   05165 Human papillomavirus infection
    101718902 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101718902 (Stat1)
   05140 Leishmaniasis
    101718902 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101718902 (Stat1)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101718902 (Stat1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 BLI1
Other DBs
NCBI-GeneID: 101718902
NCBI-ProteinID: XP_004869016
LinkDB
Position
Un
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAATDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDSFQEDPVQMSMIIFNCLKEERKILENAR
RFNQAQSGNIQSTVMLDKHKELDCKVRNVKDQVMSIEQEIKTLEDLQDEYDFKCKTSQNR
EHETNGVAKNDQKQEQLLLHQMYLMLDNKRKEIIHKIRELLNATELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQGWFTVVAESLQQVRQQLKKLEELEQKFTYEQDPITKNKQG
LWDRTFALFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLVVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLCEVLSWQFSSVTKRGLSGDQLNMLGEKLLGPNAAPDGLIPWT
RFCKENINDKNFSFWLWIESILELIKKHLLSLWNDGCIMGFISKERERVLLKDQQPGTFL
LRFSESSREGAITFTWMERSQNGGEPEFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIMGPVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgagctccaacagctggactccaagttcctggagcaggtccaccag
ctctatgatgacagtttccccatggaaatcaggcagtacctggcccagtggctagaaaag
caagactgggagcatgcagccactgatgtgtcctttgccaccattcgcttccatgacctc
ctgtcgcagctggatgatcagtacagtcgcttctctttggagaataactttttgttgcag
cacaacataaggaagagcaagcgcaacctgcaggatagtttccaggaagacccagtacag
atgtctatgatcatctttaactgcctgaaggaggaacggaaaattttggaaaacgccagg
agatttaaccaggcccagtcggggaatattcagagcactgtgatgttagacaaacacaaa
gagcttgactgcaaagtcagaaatgtgaaggaccaagtcatgagtatagagcaggagatc
aaaaccctagaagatttacaagatgaatatgattttaaatgcaaaacctcgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgaccagaaacaagaacagctgttactccat
cagatgtatttaatgcttgacaataagagaaaggaaataattcacaaaatcagagagctg
ttgaatgccacagagctgacccagaacaccctcatcaatgacgagctggtggagtggaag
cggcggcagcagagtgcctgcatcggggggccgcccaacgcctgcctggaccagctgcag
ggctggttcaccgtggtggccgagagtctgcagcaggtgcggcagcagctcaagaagctg
gaggagctggagcagaagttcacctacgagcaggacccgatcaccaagaacaagcagggt
ctgtgggaccgcacctttgccctcttccagcagctcatccagagctcctttgtggtggaa
agacagccatgcatgccaacgcatccacagaggcctctggtcttgaagactggagtacag
ttcactgtaaagttgagactgttggtgaaattgcaagagctgaattataacttgaaagtg
aaagtcttatttgataaggatgtgaacgagagaaacacagtaaaggggttccggaagttc
aacatcctgggcacacacaccaaagtcatgaacatggaggagtccaccaacggcagcctg
gcggccgagttccggcacttgcaactgaaagaacagaagaacgctggcaacagaaccaac
gagggtcctctggttgttactgaagaacttcactcccttagcttcgaaacccagttgtgc
cagcctggcttggtcattgacctcgagacgacctcgctgcctgtggtggtgatctccaac
gtcagccagctgcccagcggctgggcctccatcctgtggtacaacatgctggtggcggaa
cccaggaacctgtctttcttcctgaacccaccctgtgcacggtggtcacagctctgcgag
gtgctgagttggcagttttcatccgtcaccaagaggggcctgagcggggaccagctgaac
atgctgggagagaagcttcttggtcctaatgctgccccggatggtctcatcccctggact
aggttttgtaaggaaaacatcaatgataaaaacttttccttctggctttggatcgaaagc
atcctagaactcattaaaaaacacctgctgtctctctggaacgacgggtgcatcatgggc
ttcatcagcaaggagcgggaacgcgtgctgctcaaggaccagcagcccgggaccttcctg
ctgcggttcagcgagagctcccgagagggcgccatcaccttcacctggatggagcgctcg
cagaacggaggtgaacccgagttccatgcggttgaaccctacaccaagaaagagctttct
gccgttactttccctgacatcatccgcaattacaaagtcatggctgcggagaatattcca
gagaaccccctcaagtacctatacccaaacattgacaaagaccacgcgtttggaaagtat
tactccaggccgaaagaagcaccagagccgatggagctcgatggccctaaaggaactggc
tacatcaagactgagttgatttctgtgtctgaagttcacccttctagacttcagaccaca
gacaacctgctccccatgtctcccgaggaattcgacgaagtgtcccggatcatgggcccc
gtggaatttgacagtatgatgaatgctgtataa

KEGG   Heterocephalus glaber (naked mole rat): 101721899
Entry
101721899         CDS       T02812                                 

Gene name
Stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04217  Necroptosis
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl04917  Prolactin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04931  Insulin resistance
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05145  Toxoplasmosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05212  Pancreatic cancer
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101721899 (Stat3)
   04066 HIF-1 signaling pathway
    101721899 (Stat3)
   04068 FoxO signaling pathway
    101721899 (Stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101721899 (Stat3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101721899 (Stat3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101721899 (Stat3)
   04062 Chemokine signaling pathway
    101721899 (Stat3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101721899 (Stat3)
   04917 Prolactin signaling pathway
    101721899 (Stat3)
   04935 Growth hormone synthesis, secretion and action
    101721899 (Stat3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101721899 (Stat3)
   05206 MicroRNAs in cancer
    101721899 (Stat3)
   05205 Proteoglycans in cancer
    101721899 (Stat3)
   05203 Viral carcinogenesis
    101721899 (Stat3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101721899 (Stat3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101721899 (Stat3)
   05221 Acute myeloid leukemia
    101721899 (Stat3)
   05223 Non-small cell lung cancer
    101721899 (Stat3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101721899 (Stat3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101721899 (Stat3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101721899 (Stat3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101721899 (Stat3)
   05160 Hepatitis C
    101721899 (Stat3)
   05171 Coronavirus disease - COVID-19
    101721899 (Stat3)
   05162 Measles
    101721899 (Stat3)
   05163 Human cytomegalovirus infection
    101721899 (Stat3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101721899 (Stat3)
   05169 Epstein-Barr virus infection
    101721899 (Stat3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101721899 (Stat3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101721899 (Stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101721899 (Stat3)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101721899 (Stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N DUF4795 AP1AR Baculo_PEP_C Fib_alpha
Other DBs
NCBI-GeneID: 101721899
NCBI-ProteinID: XP_004859396
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNSQAATRQKMQQLEQMLTALDQMRRSIVSELAGLLSAVEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEAETGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTPECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctggacacgcgctacctggagcagctgcaccag
ctgtacagcgacagcttccccatggagctgcggcagttcctggcgccctggattgagagc
caggactgggcgtacgcggccagcaaggagtcgcacgccacactggtgttccacaacctc
ctgggcgagatcgaccagcagtacagccgcttcctgcaggagtccaatgtcctctaccag
cacaacctgcgccgtatcaagcagttcctgcagagcaggtacctggagaagcccatggag
atcgcgcgcatcgtggcacggtgcctgtgggaggagtctcggctcctgcagacggcggcc
accgctgcccagcaagggggccaggccaaccacccgacggccgctgtggtgacggagaag
cagcagatgctggagcagcacctgcaggacgtgcggaagcgggtgcaggacttggagcag
aaaatgaaggtggtggagaacctgcaggatgacttcgatttcaactacaagaccctcaaa
agccagggagacatgcaggacctgaacgggaacagccaggctgccacgcggcagaagatg
cagcagctggagcagatgctgacggcgctggaccagatgcgcaggagcatcgtaagcgag
ctggcagggctgctgtcggctgtggaatacgtgcagaagaccctcacagacgaggagctg
gctgactggaagcggcggcagcagatcgcgtgcattgggggcccgcccaacatctgcttg
gaccgcctggagaactggatcacctccttggcggagtcgcagctgcagacgcgccagcag
attaagaagctggaggagctgcagcagaaggtctcctataagggtgaccccatcgtgcaa
caccggcccatgctggaggagaggatcgtggagctattcagaaacctgatgaaaagcgcc
ttcgtggtggagcggcagccctgcatgcccatgcaccccgaccggcccttggtcatcaag
acgggcgtccagttcaccaccaaagtcaggctgctggtcaagttcccggagttgaattat
cagcttaaaattaaagtgtgcatcgacaaggactcgggggacgtggcggcgcttcgtggg
tcccggaagttcaatatcctgggcaccaacacaaaggtgatgaacatggaggagtccaac
aatggcagcctctctgcggagttcaagcacctgactctccgggagcagagatgtgggaac
ggaggccgcgccaactgcgacgcctccctgattgtgactgaggagctgcacctgatcacc
ttcgagaccgaggtctaccaccagggcctcaagatcgacctcgagacgcactcgcttcct
gtcgtggtgatctccaacatctgccagatgcccaacgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagcccccgatcgggacg
tgggaccaggtggccgaggtgctgagctggcagttctcctccaccaccaagcgcggcctg
agcatcgagcagctgaccacgctggccgagaagctcctaggacccggtgtgaactactcg
ggctgtcagatcacgtgggcaaagttctgcaaggagaacatggcgggcaagggtttctcc
ttctgggtgtggctggacaacatcatcgacctggtgaagaagtacatcctggccctgtgg
aatgagggatacatcatgggcttcatcagcaaggagcgggagcgcgccatcctgagcacc
aagccgcccggcaccttcctgctgcgcttcagcgagagcagcaaggagggtggcgtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcggtggagccatac
accaagcagcagctgaacaacatgtcatttgccgagatcatcatgggctataagatcatg
gatgccaccaacatcctggtgtccccactggtctacctgtaccctgacatccccaaggag
gaggcctttgggaagtactgccggcccgagagccaggagcacccggaagctgaaacaggt
agtgccgccccctacctgaagaccaagttcatctgcgtgaccccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgagccctcagcaggagggcagttcgagtccctcacgtttgacatggag
ctgaccccggagtgcgctacctcgcccatgtga

KEGG   Heterocephalus glaber (naked mole rat): 101722721
Entry
101722721         CDS       T02812                                 

Gene name
Stat5b
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04012  ErbB signaling pathway
hgl04062  Chemokine signaling pathway
hgl04217  Necroptosis
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04917  Prolactin signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05161  Hepatitis B
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101722721 (Stat5b)
   04630 JAK-STAT signaling pathway
    101722721 (Stat5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101722721 (Stat5b)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101722721 (Stat5b)
   04659 Th17 cell differentiation
    101722721 (Stat5b)
   04062 Chemokine signaling pathway
    101722721 (Stat5b)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101722721 (Stat5b)
   04935 Growth hormone synthesis, secretion and action
    101722721 (Stat5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101722721 (Stat5b)
   05203 Viral carcinogenesis
    101722721 (Stat5b)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101722721 (Stat5b)
   05220 Chronic myeloid leukemia
    101722721 (Stat5b)
   05223 Non-small cell lung cancer
    101722721 (Stat5b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101722721 (Stat5b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101722721 (Stat5b)
   05161 Hepatitis B
    101722721 (Stat5b)
   05162 Measles
    101722721 (Stat5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101722721 (Stat5b)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101722721 (Stat5b)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 101722721
NCBI-ProteinID: XP_004859399
UniProt: A0A0P6J6Q9
LinkDB
Position
Un
AA seq 786 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKAAQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPLELVRCIRHILYNEQRLV
REAASGSAPAGSLADALSQKHLQINQAFEELRLGTQDTESELKKLQQAQEYFIIQYQESL
RLQAQFAQLAQLSPQERLSRESALQQKQATLEAWLQREAQTLQRYRVELAEKHQKTLQLL
RKQQTVILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAELIWQNRQQIRRAEHLC
QQLPIPGPVEEMLADVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKALLKNESTRNESSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSIGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSTRGLTKENLVFLAQKLFNS
GSSHLEDYSGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCERDTAKAVDGYVKPQIKQVVPEFATASADTGA
SATYMDQAPSPAVCPQAPYSMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDTQW
MPHTQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggctgtgtggatccaagcccagcagctgcagggggacgccctgcaccagatgcaagcc
ttgtacggccagcacttccccattgaggtgcgccactacctgtcccagtggatagagagc
caggcctgggactcaatagatcttgataatccacaggagaacattaaggccgcccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaggacggg
ttcctgctgaagatcaagctgggccactacgccacgcagctgcagaacacctacgaccgc
tgccccctggagctcgtccgctgcatccggcacatcctgtacaacgagcagaggctggtc
cgggaggccgccagtggcagtgccccggctggaagcctggcagacgccctgtcccagaag
cacctgcagatcaaccaggcattcgaggagctgcggctggggacacaggacacggagagc
gagctgaagaagctgcagcaggcccaggagtacttcatcatccagtaccaggagagcctg
cggctccaggcccagttcgcacagctggcccagctgagcccccaggagcggctgagccgg
gagtcagccctgcagcagaaacaggcgacgctggaggcctggctgcagcgcgaggcgcag
acgctgcagcgctaccgcgtggagctggccgagaagcaccagaagacgctgcagctgctg
cgcaagcaacagactgtcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggaggcccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggccgagctcatctggcagaaccggcagcagatccgcagggccgagcacctgtgc
cagcagctgcccatccctgggccggtggaggagatgctggctgacgtcaacgccaccatc
acggacatcatctcggccctggtcaccagcaccttcatcatcgagaagcagcccccgcag
gtgctgaagacacagaccaagttcgcggccaccgtgcggctgctggtgggcgggaagctg
aacgtgcacatgaacccgccgcaggtgaaggccaccatcatcagcgagcagcaggccaag
gccctgctcaagaacgagagcacgcgcaacgagagcagtggcgagatcctgaacaactgc
tgcgtcatggagtaccaccaggccaccggcacactcagcgcccacttccgcaacatgtct
ctgaaacggatcaagaggtcggaccggcgaggggcagagtcggtgacggaggaaaagttc
accatcctgttcgagtcacagttcagcatcggtgggaacgagctggtcttccaggtcaag
accctgtcgctcccggtggtggtgatcgtccacggcagccaggacaacaatgccactgcc
accgtgctgtgggacaacgccttcgccgagcccggccgggtgccgtttgccgtgcctgac
aaggtgctgtggccccagctgtgtgaggcgctcaacatgaagttcaaggccgaggtgcag
agcacgcggggcctgaccaaggagaacctggtgttcctggcacagaaactgttcaacagc
ggcagcagccacctggaggactacagcggcatgtccgtgtcctggtcacagttcaacagg
gagaacctgccaggacggaactacaccttctggcagtggttcgacggcgtgatggaggtg
ttaaagaagcacctcaaaccccactggaatgacggcgccatcctgggcttcgtgaacaag
cagcaggcacacgacctgctcatcaacaagcctgacgggaccttcctgctgcgcttcagc
gactcagagatcgggggcatcaccatcgcctggaagtttgactcccaggagaggatgttc
tggaacctgatgcccttcaccacccgggacttctccatccggtccctggccgaccgcctg
ggggacctgaactacctgatctacgtcttccctgaccggccgaaggacgaggtgtactcc
aagtactacacgcccgtcccctgcgagcgtgacaccgctaaagccgtggacggctatgtg
aagccacagatcaagcaggtggtccccgagttcgcgactgcgtctgcagatactggggcc
agcgccacctacatggaccaggccccgtccccggccgtgtgtccccaggctccatacagc
atgtacccgcagaaccccgactccgtcctggacactgacggggacttcgacctggaggac
acgatggacgtggcacgccgcgtggaggagctcctgggccggcccatggacactcagtgg
atgccccacacgcagtcgtga

KEGG   Heterocephalus glaber (naked mole rat): 101725744
Entry
101725744         CDS       T02812                                 

Gene name
Stat6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04217  Necroptosis
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05161  Hepatitis B
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101725744 (Stat6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101725744 (Stat6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101725744 (Stat6)
   04659 Th17 cell differentiation
    101725744 (Stat6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101725744 (Stat6)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101725744 (Stat6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101725744 (Stat6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101725744 (Stat6)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101725744 (Stat6)
SSDB
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2 HisKA_2
Other DBs
NCBI-GeneID: 101725744
NCBI-ProteinID: XP_004861317
LinkDB
Position
Un
AA seq 854 aa
MPGSCSLNKAPSKPQIMSLWSLVSKMSPEKLQRLYVDFPQHLRHLLGDWLEDQPWEFLVS
SDAFCCNVASALLSATVQRLQASAGEQGEGNTVLQHISTLESIYQRDPLKLVATFRQILQ
GEKKAVMEQFHHLPMPFHWKQEELKFNTALQRLQHRVGEIRLLQEALHQGTEAGQVSLHS
LIDTPANGTGPNEALGTLLQETIRELEMAQTLVLKRIQIWKRQQQLAGNGAPFEESLATL
QERCESLVDIYSQLQQEVGAAGGELEHKTQAALIHRLDEVLQSLVTSSFLVEKQPPQVLK
TQTKFQAGVRFLLGLRFLGAPAKPPLVRADMVTEKQARELSMPQGPGAGTESTGEIINNT
VPLENSIPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSTSFMLGPNKLPIQLQ
ALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVVERVPWEKMCETLNLKFMAEVG
TNRGLLPEHFLFLAQKIFNDNSLSMETFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDL
TKRCLRSYWSDRLIIGFISKQYVTNLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSP
QIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPA
TIKMTVERDQPLPTPEPQMPTMMPSYDLGMTPDPSVSMQLSQDRMPPLYPQHSHPIPPYQ
GLPQEESVNVLPAFQEPHLQMPPPLSQISLPFDQPHPQGLLPCQPQEHAVDVTMDEDSCL
NQPVGRYHQGTWVDEDMFPALLPPTEQDLTKLLLEGQGEAGGGTLGVQPLLQPSPYGHSG
ISMSHRDLRANPSW
NT seq 2565 nt   +upstreamnt  +downstreamnt
atgccaggaagctgttcactcaacaaggcaccctccaaaccccagatcatgtctctgtgg
agtctggtctccaagatgtccccagaaaaactacagcggctctatgttgactttcctcag
cacctgaggcatctcttaggtgactggcttgaggaccagccatgggagttcctggtcagc
tcagatgccttctgttgcaacgtggcaagtgccctactttcagccactgtccagcgcctt
caggcttctgcaggagagcagggagagggaaacaccgtcttgcaacacatcagcaccctg
gagagcatataccagagggaccccctgaagcttgtggctactttcagacaaatacttcaa
ggagaaaaaaaagctgttatggagcagttccaccacctgccaatgcccttccactggaag
caagaagaactcaagtttaacacagccctgcagaggctgcagcaccgagttggggagatc
cgccttctccaagaagccctgcatcaggggactgaagctggacaagtgtctctgcacagc
ttgatagatactcctgccaatgggactgggccaaatgaggccctgggcacgctgctgcag
gagaccattagggagctggagatggctcagaccctagtgctgaagaggatccagatttgg
aaacggcagcagcagctggcagggaatggtgcaccctttgaggagagcctggccacgcta
caggaaaggtgtgagagcctggtggacatttattcccagctacagcaggaggtaggggca
gctggtggagagcttgaacacaagacccaggcagcgctgattcaccggctggatgaagtc
ctgcagagcctcgtcaccagctctttcctggtggagaagcagccccctcaggttctgaag
actcagactaagttccaagcaggagttcggtttttgctgggcctgcgattcctgggtgct
ccagccaagcctccgctggtcagggctgacatggtgactgagaagcaggcgagggagctg
agcatgccccaggggcctggggctggaacagagagcaccggggagatcatcaacaacaca
gtgcctctggagaacagcattcctgggaactgctgctctgccctcttcaagaacctgctc
ctaaagaaaatcaagcggtgtgagcggaagggcactgaatctgtcaccgaggagaagtgt
gcggttctcttctccaccagcttcatgctcggtcccaacaaactccctatccagctccag
gccctgtctctgcccctggtggtcattgtccatggcaaccaagacaacaatgccaaagcc
actatcctctgggacaatgcattctctgaaatggatcgtgtgccctttgtggtggttgag
cgggtgccttgggagaagatgtgtgaaactctgaatctcaagttcatggctgaggtgggg
accaaccggggactgctcccagagcacttcctcttcctggcccagaagatcttcaatgac
aacagccttagcatggagaccttccagcaccgttgtgtgtcctggtcacagtttaacaag
gagatcctgctgggccggggcttcaccttttggcagtggttcgatggtgtcctagacctc
accaaacgctgtctccggagctactggtcagaccggctgatcatcggcttcattagcaaa
cagtatgtcactaacctccttctcaatgagcccgatggaaccttcctgctccgcttcagt
gactctgagattggaggcatcaccattgctcatgtcatcaggggacaggatggttcacca
cagatagagaacatccagccattctctgccaaagacttgtccattcgttcactgggggac
agaatacgggatcttgctcagctcaaaaacctctaccccaagaaacccaaagatgaggct
ttccggagtcactataagcctgaacagatgggtaaggatggcaggggttatgtcccagct
actatcaagatgactgtagaaagggaccagccccttcccaccccagagccccagatgcct
accatgatgccctcttatgatcttggaatgacccctgatccctccgtgagcatgcagctc
agccaagacaggatgcccccgttgtaccctcaacattctcatcccatcccaccgtatcaa
ggcctcccccaagaagagtcggtcaatgtgctaccagccttccaggagcctcacctgcag
atgcccccaccgctgagccagataagtctgccctttgaccagcctcacccacagggcctg
ctgccgtgtcagcctcaggagcatgctgtagacgtgaccatggatgaagacagctgccta
aaccagccagtgggaaggtaccaccagggcacttgggttgatgaagacatgttccctgcc
ctgctgcctcccactgaacaggacctcaccaagcttctcctagaaggccaaggggaggca
gggggagggaccttgggagtccagcctctcctgcagccttccccctatgggcactctggg
atctcaatgtcccaccgggacctaagagccaaccccagttggtga

DBGET integrated database retrieval system