KEGG   Heterocephalus glaber (naked mole rat): 101707336
Entry
101707336         CDS       T02812                                 

Gene name
Bak1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01524  Platinum drug resistance
hgl04141  Protein processing in endoplasmic reticulum
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05132  Salmonella infection
hgl05160  Hepatitis C
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05203  Viral carcinogenesis
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101707336 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101707336 (Bak1)
   04215 Apoptosis - multiple species
    101707336 (Bak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101707336 (Bak1)
   05202 Transcriptional misregulation in cancer
    101707336 (Bak1)
   05206 MicroRNAs in cancer
    101707336 (Bak1)
   05203 Viral carcinogenesis
    101707336 (Bak1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101707336 (Bak1)
   05212 Pancreatic cancer
    101707336 (Bak1)
   05225 Hepatocellular carcinoma
    101707336 (Bak1)
   05226 Gastric cancer
    101707336 (Bak1)
   05214 Glioma
    101707336 (Bak1)
   05216 Thyroid cancer
    101707336 (Bak1)
   05220 Chronic myeloid leukemia
    101707336 (Bak1)
   05217 Basal cell carcinoma
    101707336 (Bak1)
   05218 Melanoma
    101707336 (Bak1)
   05213 Endometrial cancer
    101707336 (Bak1)
   05224 Breast cancer
    101707336 (Bak1)
   05222 Small cell lung cancer
    101707336 (Bak1)
   05223 Non-small cell lung cancer
    101707336 (Bak1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    101707336 (Bak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101707336 (Bak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101707336 (Bak1)
   05160 Hepatitis C
    101707336 (Bak1)
   05164 Influenza A
    101707336 (Bak1)
   05162 Measles
    101707336 (Bak1)
   05168 Herpes simplex virus 1 infection
    101707336 (Bak1)
   05163 Human cytomegalovirus infection
    101707336 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101707336 (Bak1)
   05169 Epstein-Barr virus infection
    101707336 (Bak1)
   05165 Human papillomavirus infection
    101707336 (Bak1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101707336 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hgl03029]
    101707336 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hgl02000]
    101707336 (Bak1)
Mitochondrial biogenesis [BR:hgl03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101707336 (Bak1)
Transporters [BR:hgl02000]
 Other transporters
  Pores ion channels [TC:1]
   101707336 (Bak1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101707336
NCBI-ProteinID: XP_004846825
UniProt: G5BK25
LinkDB
Position
Un
AA seq 212 aa
MASNQGPGPPGEGCEEGPPPSEAEQQVARDTEEVFQSYVYYRHRQEQEAEGAVTPADPEM
DTLSLEPSSTLGQVGRRLAIIGDDINRRYDAEFQNLLQQLQPTAENAYDLFTRIASRLFK
TGITWGRVVALLGFGYRLALHVYQRGLSGFLGRVTRLVVDCMLRYCIAGWIAQRGGWVAA
LDLGNGPIRNVLLVLAVVLLGQYVVRRFFKSS
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcatccaaccaaggcccgggtccccccggggagggctgcgaggagggccccccgccg
tcggaagctgagcagcaggtggcccgggacaccgaggaggttttccaaagctacgtatac
taccgccaccggcaggagcaggaggccgagggggcagtcacccccgctgaccccgagatg
gacaccctgtccctagaaccaagcagcaccctgggccaagtgggtcggcggcttgccatc
attggggatgacatcaaccggcgctacgacgccgagttccagaacctgctgcagcagctg
cagcccacagccgaaaacgcctatgacctcttcaccaggatcgcctccaggctgtttaag
accggcatcacctggggccgtgtggtggctctcctgggctttggctatcgcctggccctg
cacgtctaccagcgtggcctgtctggcttcctgggcagggtgaccaggctggtggtagac
tgcatgctgcgctactgcattgccgggtggatcgcgcagagaggcggttgggtggcggcc
ctggacttgggcaacggccccatccggaatgtgctgctagtcctggctgtggttctgttg
gggcagtacgtggtacgaaggttcttcaagtcatcgtga

DBGET integrated database retrieval system