KEGG   Heterocephalus glaber (naked mole rat): 101707567Help
Entry
101707567         CDS       T02812                                 

Gene name
Kmt5c, Suv420h2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101707567 (Kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101707567 (Kmt5c)
Enzymes [BR:hgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101707567 (Kmt5c)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101707567 (Kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3891
Motif
Other DBs
NCBI-GeneID: 101707567
NCBI-ProteinID: XP_004866715
UniProt: A0A0P6JB59
LinkDB All DBs
Position
Un
AA seq 486 aa AA seqDB search
MPSCAQRLPAVCQRQHGPQNIMGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPV
PTLRRQQHLRSALEAFLRQRDLEAAYRALTLGDWMAHYFQSRGPRQEAALKTHVFRYLRA
FLPDSGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEDLLRAGEND
FSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAACVKALRDIEPGDEVTCFYGD
GFFGEKNEHCECYTCERKGEGAFRLQPREPELPPPPPDKYAFRETKRRLQRGQDSSWQSL
LGPRACTHLSPLRWDPFCAVCQPLRLPPCSSRLDSLPLWVQWLPQPPPRVRPRKRRCPQP
RQAQAPPALCEVQVSLHRWGGCSPHCRLRAEALVALGLPHRARWAPQQDWHWARRYGLPY
VVRVDLSRLARALPAAPAPSGTLGPTPAPAPVPKQALAFASFSPPRRLRLVVSHGSIDLD
VNSDES
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctgtgcccagcggcttcctgctgtctgtcagaggcagcatggtccacaaaac
atcatggggcccgacagagtgacagcccgagagctgtgtgagaacgatgacctggccacc
agccttgttctcgacccctacctcggcttccgcacccataagatgaacgtcagccctgtg
cccaccctgcggcgacagcagcacctgcgctcagcgctggaggccttcctacggcagcgg
gacctggaggctgcgtaccgggccctgacactgggagactggatggcccactactttcag
agccggggcccacggcaggaggctgccctcaagacccacgtgtttcgctacctccgtgcc
ttcctgcctgacagtggcttcaccatcctgccctgtacccgctactccatggagaccaac
ggggccaagatcgtgtccacccgtgcttggaagaagaacgagaagctggagctgctggta
ggctgcatcgccgagctgcgggaggccgacgaggacctgctgcgggctggcgagaatgac
ttcagcatcatgtactccacccgcaagcgtagcgcacagctgtggctaggccctgctgcc
ttcatcaaccatgactgcaaaccgaactgcaagtttgtgcctgcagatggcaatgcagcc
tgcgtgaaggcgctgcgggatattgagccaggggacgaggtgacatgcttctatggcgat
ggcttctttggggagaagaatgagcactgcgaatgctacacctgtgagaggaagggggag
ggagccttccgcctgcagcccagggagcctgagctgccgccaccgccccctgacaagtac
gcgttccgggagaccaagcggcggctgcagcgaggccaggacagcagctggcagagcctg
ctgggcccgagggcctgcacccacctgtcccccctgcgctgggacccgttctgtgctgtc
tgccagcccctgcgcctgccaccctgcagctcccgcctggacagcttgccgctctgggtc
cagtggctgccccagcccccgccccgagtgcgcccccggaagcgccggtgcccccagccc
cggcaggcccaggcgccccctgctctctgcgaggtccaggtctccctgcaccgctgggga
ggctgcagcccacactgccgcttgcgcgcagaggctctggtggccctggggctgccccat
cgtgcccgctgggccccccagcaggactggcactgggcccgccgttacgggctgccttat
gtggtgcgtgtggacctcagccgcctggcccgggccctgccggccgcccctgccccttct
ggcaccctaggccccacccctgctcccgcccctgtccccaagcaggcccttgcctttgcc
tccttctccccgcccaggcgtctgcggctcgtggtgagccacggctccatcgacctggat
gtcaacagtgatgagtcctga

DBGET integrated database retrieval system