KEGG   Heterocephalus glaber (naked mole rat): 101707605
Entry
101707605         CDS       T02812                                 

Gene name
Rassf1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04014  Ras signaling pathway
hgl04390  Hippo signaling pathway
hgl04392  Hippo signaling pathway - multiple species
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05219  Bladder cancer
hgl05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101707605 (Rassf1)
   04390 Hippo signaling pathway
    101707605 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    101707605 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101707605 (Rassf1)
   05206 MicroRNAs in cancer
    101707605 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101707605 (Rassf1)
   05223 Non-small cell lung cancer
    101707605 (Rassf1)
SSDB
Motif
Pfam: RA C1_1
Other DBs
NCBI-GeneID: 101707605
NCBI-ProteinID: XP_004834179
LinkDB
Position
Un
AA seq 414 aa
MSTEPELIELRELVPTGRPGPGGSRLERANALRITPATAHKPARQQAPGRGHHFQSAGPT
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWDPVLERDTNVD
EPVEWETPDLSQAKLEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSIK
KPPSLQDARRGLGRGTAVRRRTSFYLPKDAVKHLHVLSRTRASEVIEALLRKFLVVDDPR
KFALFERAERHGQVYFRKLSDDEQPLRLRLLAGPSEKALSFILKENDSGEVNTTVKNSSK
DYSSKSLTSKSPDLALVIIISWLSLGRVCLLGHACCILCTSPHPLPVGCLQHARITQFSA
HPAARGRRTPPTDPAEVLPLPPKDPRGPACLPPGVTCYIPGWQEESRQCQERAV
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgtcgacggagccggagctcattgagctgcgggagctggtacccactgggcgccccggc
ccgggtggcagccggctggagcgtgccaacgcgctgcgcatcacgcctgccaccgcgcac
aagcccgcacggcagcaggccccaggccgtggccaccacttccagtccgcagggcccacc
acgcacacgtggtgcgacctctgcggtgacttcatctggggcgttgtgcgcaagggcctg
cagtgcgcgcactgcaagttcacctgccactaccgttgtcgtgcgctggtctgcctggac
tgctgcgggccccgggacctgggctgggaccccgtcctggaacgggacacaaacgtggat
gagcctgtggagtgggagacacctgatctttctcaagccaaacttgaacagaagatcaag
gagtataatggccagatcaacagcaacctgttcatgagcctgaacaaagatggctcctac
acaggcttcatcaaggttcagttgaagctggtacgccctgtctcagtaccctccatcaag
aaaccaccttccttgcaggatgcccggaggggcctggggcggggcacagctgtgagacgc
cgcacctccttttacctgcccaaggatgctgtcaagcatctccatgtgctgtcacgcaca
cgggccagtgaagtcattgaggccctcctacgcaaattcttggtggtagatgatccccga
aagtttgcactctttgaacgggctgaacgtcatggccaggtgtacttccggaaactgtca
gatgatgagcagcctctgcggttacggctccttgcagggcctagtgagaaggccctgagt
ttcattctaaaggagaatgactctggggaggtaaatactactgtcaagaattctagcaaa
gactattcaagcaagagcttaacatcaaaaagcccagatctagctcttgtgatcattata
tcatggctttctctggggagggtctgcctgcttggccatgcctgctgcatcctgtgtact
tcccctcaccctcttccagtgggatgccttcagcatgccagaattacacaattttctgcg
catcctgcagcgagaggaagaagaacacctccaacagatcctgcagaagtactcccgttg
ccgccaaaagatccaagaggccctgcatgcttgccccctggggtgacctgttatatacct
gggtggcaggaggaaagtaggcagtgccaagagcgtgctgtgtga

DBGET integrated database retrieval system