KEGG   Heterocephalus glaber (naked mole rat): 101707692Help
Entry
101707692         CDS       T02812                                 

Gene name
Tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hgl01002]
    101707692 (Tmprss9)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101707692 (Tmprss9)
Peptidases [BR:hgl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101707692 (Tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101707692
NCBI-ProteinID: XP_004865930
LinkDB All DBs
Position
Un
AA seq 1055 aa AA seqDB search
MIVLALGVLLALLSTQGVQVEHNAELRGIRFSGALQRDTSDYHLALTAALERLFLSSFQK
TELETSCVGCTVLSYREGNSSVLVHFRLHFLLRALQSLSLDLEEELLQQGIREKLRESSI
SMAAYGTIVSAELTGEWKGPGIDRDLKSGRCPEGSFSCRNSQCVTKANPECDDWADCSDG
SDEELCDCGLRPAWRAAGRIVGGAEAAPGEFPWQVSLREHSEHFCGATVVGARWLVSAAH
CFNEFQDPAEWEAHAGSTVLSGLEAGAVRMRVARIARHPLYNADTADFDAAVLELARPLP
LGRHIQPACLPAASHAFPPGSKCLISGWGYLKEDVLVKPEVLQKATVELLDQAVCASLYG
HSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEAQRPGVYAR
VTRLRDWILEVTGVASSLLAPTVAPGPATASTAKLTSPNTPAKAMPAPSTAALDTVTAAK
TQECGARPAMEKPIRIVGGAGAMSGEVPWQASLKEGTRHFCGATVVGDRWLLSAAHCFNH
TRAEQVQAHLGTTSLLGIGGSPVKLGLRQVMLHPRYNPGTLDFDVAVLELARPLVFSKYI
QPVCLPLAIQKFPVGRKCMISGWGNTQEGNATKPDVLQRASVGIVDQKTCSVFYNFSLTD
RMLCAGFLEGGVDSCQGDSGGPLACEENPGVFYLAGIVSWGIGCAQAKKPGVYARITRLK
GWVLGIMSSGTLPTSPPPTRRTPATTGHSPRTMTSLMALGVTTSRPSTPRATSRVTVLPG
TTTLSAVGGTTRGQTPPPGAPETTTRFQLPDCGLAPAVALARIVGGSAAGRGEWPWQVSL
WLRRREHRCGAVLVAERWLLSAAHCFDVYGDPQQWVAFLGTPFLSGAEGQLERVASIYKH
PFYNLYTLDYDVALLELAGPVRRSRLVHPICLPGPAPRPTDGARCVITGWGSVREGGSMA
RQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCLGDAGGPLACREPSGRWVL
TGVTSWGYGCGRPHFPGVYTRVLAVRGWISQHIQE
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtccttgccctgggagttcttttggccctcctctctacgcagggcgtccaggtg
gagcacaacgctgaactccgcggaatccgcttctccggcgcgctgcagcgcgacacctcg
gactatcacctcgcgctcaccgccgcgctggagaggctgtttctaagtagtttccagaag
acggagttagaaacaagctgcgtgggctgcacagttctcagttacagggaagggaattct
agcgtcctggtgcatttccggctgcactttctgcttcgagccctccagtcactgagtctg
gacctggaggaggaattattacagcagggcatccgggagaagcttcgagaaagcagcatc
tcgatggctgcctatggcaccattgtgtcggctgagctcacaggtgagtggaagggaccg
gggatcgacagggacctaaagtcaggccgctgtcccgagggctccttctcctgccgcaat
agccagtgtgtaaccaaagcgaacccggagtgtgatgactgggccgactgctcggatggc
tcggacgaggagctctgtgactgtggcctgcggccagcctggagggctgcgggccggatc
gtgggcggtgcggaggcagctccgggcgagttcccctggcaggtcagcctgcgtgagcac
agcgaacacttctgtggggccaccgtcgtgggcgcccggtggctggtgtctgccgcccac
tgcttcaacgagttccaggaccccgccgagtgggaggcgcacgcgggctccacggtgctg
agcggcttggaggccggtgcggtacgcatgcgcgtggcgcgcatcgccaggcacccgctg
tacaacgcggacaccgctgacttcgacgcggcagtgctggagctggcgcgtcccctgccc
cttggccgccacatccagcccgcctgcctcccggccgcctctcacgccttcccgcctggc
agcaagtgcctcatctcgggctggggctacctcaaggaggacgtccttgtcaagccagag
gtgctgcagaaagccaccgtggagctgctggaccaggccgtgtgtgccagcctgtatggc
cactcactcaccgacaggatgttatgtgccggctacctggatgggaaggtggactcctgc
cagggcgattcgggaggccctctggtctgtgaggagccctcgggcaggttcttcctggca
ggcatcgtgagctggggcatcggctgcgcagaagcccagcgcccgggggtctatgcccgg
gtcaccaggctgcgggactggatcctggaggtcaccggtgtggccagctcacttctggcc
cccactgtggctcctggccctgccactgccagtactgccaagctcaccagccccaatacc
cctgccaaagccatgcctgcccccagcactgcagccctcgacactgtcaccgcagccaag
acacaagagtgcggggccaggcctgccatggagaagcccatccgcatcgtgggtggggcc
ggggccatgtccggggaggtgccctggcaggccagcctgaaggaagggaccaggcacttc
tgcggagccactgtggtgggcgaccgctggctgctgtctgccgcccactgcttcaaccac
acacgggcggagcaggtgcaggcccacctgggcaccacgtccctcctgggcatcggcggg
agccccgtgaagctggggctgcggcaggtgatgctccatccgcgctacaacccgggcacc
ctggacttcgacgtggctgtgctggagctggccaggcccctggtcttcagcaagtacatc
cagcccgtctgcctcccgctggccatccagaagttcccggtgggccgcaagtgcatgatc
tcgggctggggcaacacacaggaagggaatgccaccaagcctgatgttctgcagcgggcg
tccgtgggcatcgtggaccagaaaacctgcagcgtgttctacaacttctcactcaccgac
cgcatgctgtgcgctggcttcctggagggcggggtggactcttgccagggcgactcgggg
ggccccctggcctgtgaggagaaccctggtgtgttctacctggcggggatcgtgagctgg
ggcatcggctgtgcccaggccaagaagcctggtgtgtacgcgcgcatcaccaggctgaag
ggctgggtcctgggcatcatgtcctcggggaccctacccacgtcacccccgcccaccagg
aggacaccagccaccaccggccactcccctaggacaatgaccagcctcatggccctggga
gtcaccaccagcagaccctccacacccagggccaccagccgggtgactgtcctgcctggc
accaccactctgtctgctgtgggcggaaccaccagaggacagacaccacctccaggtgcc
ccagagaccaccacgcgcttccagctgccagactgtggcctggcgccggctgtggcgctg
gccaggatcgtgggcggcagcgctgcgggccgcggcgagtggccatggcaggtgagcctg
tggctgcggcgccgggaacaccgctgcggggccgtgctggtggcagagaggtggctgcta
tcggctgcgcactgctttgatgtctacggggacccgcagcagtgggtcgccttcctgggc
acgccgttcctgagcggcgccgagggccagctggagcgcgtggcgagcatctacaagcac
ccgttctacaacctctacacgctggactacgatgtggcactgctcgagctggccgggccc
gtacgccgcagccgcctggtgcaccccatctgcctgcctggccccgcaccaagacccacg
gacggcgcgcgctgtgtgatcaccggctggggctctgtgcgcgagggaggctccatggca
cgacagctgcagaaggccgccgtgcgcctcctcagcgagcagacttgtcgtcgcttctac
ccggtgcagatcagcagccgcatgctgtgcgcgggcttccctcagggcggcgtggacagc
tgcttgggcgatgctggcggaccactggcctgcagggagccttctggccgctgggtgcta
actggggtcaccagctggggctatggctgcggcaggccccacttcccaggtgtctacact
cgggtgttggccgtgagaggctggataagccagcacatccaggagtga

DBGET integrated database retrieval system