KEGG   Heterocephalus glaber (naked mole rat): 101707892
Entry
101707892         CDS       T02812                                 

Gene name
Gfap
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101707892 (Gfap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101707892 (Gfap)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hgl04812]
    101707892 (Gfap)
Membrane trafficking [BR:hgl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    101707892 (Gfap)
Cytoskeleton proteins [BR:hgl04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     101707892 (Gfap)
SSDB
Motif
Pfam: Filament Filament_head Jnk-SapK_ap_N Topoisom_I_N Spc7 PfkB Cbl_N T6PP_N GAS Snu56_snRNP
Other DBs
NCBI-GeneID: 101707892
NCBI-ProteinID: XP_004859245
LinkDB
Position
Un
AA seq 448 aa
MERRLVSSVRRSYASSSSETVARGLRAVRRLGPDPRPAPAWVSPPLPARLDFSLAGALNT
GFKQTRASERAQMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAAEPTRLADVYQAEL
QELRLRLDQLMAGSARVEVERDNLALDLGALQQKLQDEATLRLQAENSLASYRQEADDAT
LAHLDLERKIESLEEEIRFLGKIHEEEVRELQEQLAKQQVHVEMDVAKPDLTAALREIRT
QYAAAASSNMQEAEEWYRSKFTDLTDAAARNAELLRQAKHEASDYRRQLQALTCDLESLR
GTNESLERQMREQEERHSREASTYQEALARLEEEGRGLKEQMARHLQEYQELLNVKLALD
MEIATYRKLLEGEENRITIPVQTFSNLQIRETSVDTKSVLEGHLRRNIVLKTVEMRDGEV
SSPAPALPAGLSHPQVTQESKQEHKDAM
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggagcgcagactcgtgtcctctgtccgtcgctcctatgcttcctcctcctcggagaca
gtggctaggggcctgcgggccgtgcgccgcctgggtccagacccccgccctgccccggcc
tgggtgtcccctccgctcccggcccggctggacttctcgctggctggggctctcaacact
ggcttcaagcagacacgggccagcgagcgggcccagatgatggagctcaatgaccggttt
gccagctacatcgaaaaggtccggttcctggagcagcagaacaaggccctggctgctgag
ctgaaccagctgcgggctgcagagcccacccggctggccgacgtctaccaggccgagctc
caggagctgcggctgcggctggaccagctcatggcaggcagcgcccgggtggaggtggag
cgcgacaacctggccctggacctgggcgccctgcagcagaagctccaggatgaagccacc
ctgaggctgcaggccgagaacagcctggccagctacagacaggaggccgacgacgccacc
ctggcccatctggacctggagaggaaaatcgagtctctggaggaggagatccggttcctg
gggaagatccatgaggaggaggttcgggagctccaggagcagctggccaagcagcaggtc
cacgtggagatggacgtggctaagcccgacctcacggcggccctgagggagatccgcacg
cagtatgcggccgcggcctccagtaacatgcaggaggcagaggagtggtaccgctccaag
ttcaccgacctcacggacgccgctgcccgaaatgctgagctgctgcgccaggccaagcat
gaggccagcgactaccggcgccagctgcaggccctgacctgtgacctggagtcccttcgg
ggcacgaacgagtccctagagcggcagatgcgcgagcaggaggagcgccactcgagagag
gcttccacctaccaggaggcgctggcccggctggaggaggaaggccggggcctcaaggag
cagatggcccggcacctgcaggagtaccaggagctgctcaacgtcaagctggccctggac
atggagattgccacctaccggaagctgctggagggcgaggagaaccgcatcaccattccc
gtgcagactttctccaacctgcagatccgagagaccagcgtggacacgaagtccgtgttg
gaaggccacctcaggaggaacatcgtgctcaagacagtggagatgcgtgacggggaggtg
agcagccccgccccggccctgccagctgggctgtctcaccctcaggtcactcaggagtcc
aagcaggagcacaaggacgccatgtga

DBGET integrated database retrieval system