KEGG   Heterocephalus glaber (naked mole rat): 101709405Help
Entry
101709405         CDS       T02812                                 

Gene name
Pfkp
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00010  Glycolysis / Gluconeogenesis
hgl00030  Pentose phosphate pathway
hgl00051  Fructose and mannose metabolism
hgl00052  Galactose metabolism
hgl01100  Metabolic pathways
hgl01200  Carbon metabolism
hgl01230  Biosynthesis of amino acids
hgl03018  RNA degradation
hgl04152  AMPK signaling pathway
hgl05230  Central carbon metabolism in cancer
Module
hgl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101709405 (Pfkp)
   00030 Pentose phosphate pathway
    101709405 (Pfkp)
   00051 Fructose and mannose metabolism
    101709405 (Pfkp)
   00052 Galactose metabolism
    101709405 (Pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101709405 (Pfkp)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101709405 (Pfkp)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101709405 (Pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101709405 (Pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hgl03019]
    101709405 (Pfkp)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101709405 (Pfkp)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101709405 (Pfkp)
Messenger RNA biogenesis [BR:hgl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101709405 (Pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101709405
NCBI-ProteinID: XP_004854629
UniProt: A0A0P6K2H8
LinkDB All DBs
Position
Un
AA seq 791 aa AA seqDB search
MGDGSSSTPKTSFPKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFI
YEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKAFRTREGRLKAALNLVQLGIT
NMCVIGGDGSLTGANIFQEEWSGLLEELAQNGKISEEAVKMHGYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEENMCIKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPEIPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDGGRFKDAVKLRGRSFEGNLKTYKRLAIKLPDDQIPKSNCNVAVINVGA
PAAGMNAAVRSAVRVGIAEGHKMFAVYDGFDGFAKGHIKEIGWADVGGWTGQGGSILGTK
RTLPGKYLEQIAEQIHVHNINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITTKLKGSQGKAKKFVTNDSICLL
GIRKRNLLFQPVTELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDAGQLEPVH
QHGTQGELADI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacggctcctcctcgacccccaagacctccttcccgaagttcctggagcatctc
tccggcgccggcaaggccattggtgtgctcaccagcggcggggatgcccaaggtatgaac
gctgccgtccgggctgtggtgcgcatgggaatatacacgggggccaaagtgtactttatc
tatgagggttaccagggcatggtagatggaggttctaacatcgtggaagcagactgggag
agtgtctcaagcatcctacaagtgggtgggacaattattggcagtgcccgctgcaaagcc
tttcgtacccgggaaggtcgcttgaaagctgctctcaacttggttcagctgggcattacc
aacatgtgtgtgatcggcggggatgggagcctcacaggggccaacatcttccaggaggag
tggagtggactgctggaggagttggcccagaatggtaagatcagtgaagaagccgtgaag
atgcatggttatctcaacgtggtgggcatggtgggctccatagacaacgacttctgtggc
acagatatgaccattggcacagactcggctttgcacagaattatcgaagttattgatgcc
atcatgaccactgcccagagccaccagagaacctttgtcctagaggtgatgggcagacac
tgtgggtacttggccttggtgagtgccttggcctgcggcgcagactgggttttcctccca
gagtctccaccggaagaaggttgggaggagaacatgtgcatcaaactctcagagaatcgt
gcccggaaaaaaaggctaaatattatcattgtggctgaaggagcaattgatacccaaaat
aaacctattacctctgaaaaaattaaggagcttgtggtaacacagctgggatatgacact
cgagtgaccattcttggacatgtacaaagaggcggaaccccttctgcgtttgacaggatt
ttggctagtcgcatgggggtggaggcggtcattgccttgctagaggccacccctgagatc
cctgcctgtgttgtgtcactgaatggaaaccatgccgtgcgcctgcccctgatggagtgt
gtacagatgacccaggatgtacaaaaggcaatggatgggggaagatttaaggatgccgtg
aaactccgagggaggagctttgaaggcaacctgaagacctataagcgacttgccatcaag
ctgcctgatgatcagatcccaaagagcaactgcaacgtagctgtcatcaatgtgggggca
cccgctgctggtatgaacgcggctgtgcgctctgccgtgcgagtgggcattgccgagggc
cacaagatgttcgcagtctatgatggctttgacggcttcgccaaaggccatatcaaagaa
atcggctgggcagatgttggaggttggactggacaaggagggtccattcttgggacaaaa
cgtaccttacctgggaagtacttggagcagatcgctgaacagattcatgtccataacatc
aatgccctcttgatcattggtggatttgaggcctacctgggactcctagagctgtcagct
gcccgggagaaacacgaggaattctgtgtccctatggttatggttcctgctactgtctcc
aacaatgtgcccggttccgatttcagcatcggggcagacacagctctgaacactatcaca
gacacatgtgaccgaatcaaacagtccgccagtgggactaagcgtcgtgtgttcatcatc
gagaccatggggggctactgcggatacctagccaacatggggggacttgcggccggagcc
gatgccgcctacatttttgaagagccatttgacatcagagacctgcagtccaatgtggag
cacctcacagagaaaatgaagaccaccatccaaagaggtcttgtgctcagaaatgagagc
tgtagtgagaattacaccaccgacttcatttaccagctctactccgaagaaggaaaaggg
gtatttgactgcagaaagaacgtgctgggacacatgcagcagggtggagcaccttctcca
tttgatagaaactttggaaccaaaatctctgcccgagccatggaatggatcaccaccaaa
ctgaagggatcccagggcaaagcaaaaaaatttgtaactaatgattccatttgtctgctt
ggaatacgcaaaagaaacttgctttttcaacctgtaacagagctgaagaaggaaacagat
tttgagcacagaatccccaaggaacagtggtggctaaaactccggccactcatgaagatc
ttggccaaatacaaagcgagttatgatgtgtctgacgctgggcagctggagcccgtgcat
caacatggcactcagggggagcttgcagacatctga

DBGET integrated database retrieval system