KEGG   Heterocephalus glaber (naked mole rat): 101710283
Entry
101710283         CDS       T02812                                 

Gene name
Jak1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04151  PI3K-Akt signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04621  NOD-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05140  Leishmaniasis
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05212  Pancreatic cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101710283 (Jak1)
   04151 PI3K-Akt signaling pathway
    101710283 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101710283 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101710283 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101710283 (Jak1)
   04658 Th1 and Th2 cell differentiation
    101710283 (Jak1)
   04659 Th17 cell differentiation
    101710283 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101710283 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101710283 (Jak1)
   05203 Viral carcinogenesis
    101710283 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101710283 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101710283 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101710283 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101710283 (Jak1)
   05161 Hepatitis B
    101710283 (Jak1)
   05160 Hepatitis C
    101710283 (Jak1)
   05171 Coronavirus disease - COVID-19
    101710283 (Jak1)
   05164 Influenza A
    101710283 (Jak1)
   05162 Measles
    101710283 (Jak1)
   05168 Herpes simplex virus 1 infection
    101710283 (Jak1)
   05163 Human cytomegalovirus infection
    101710283 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101710283 (Jak1)
   05169 Epstein-Barr virus infection
    101710283 (Jak1)
   05165 Human papillomavirus infection
    101710283 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101710283 (Jak1)
   05140 Leishmaniasis
    101710283 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101710283 (Jak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101710283 (Jak1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101710283 (Jak1)
Protein kinases [BR:hgl01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101710283 (Jak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 Kinase-like RIO1 SH2
Other DBs
NCBI-GeneID: 101710283
NCBI-ProteinID: XP_004841577
LinkDB
Position
Un
AA seq 1154 aa
MQYLNIKEDCSAMAFCAKMRSSKKAEVNQVAPKPGVEVTFYLPDRGPLRLGTGEYTAEEL
CIQAAQECCISPLCHNLFALYDENTKLWYAPNRVITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKSSYEKRKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKVQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNTTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLRISSENEMN
WFHSSEGASTLCYEVMVTGNLGIQWRQKPNAVPAEKEKNKLKRKKLENKHKKDEEKNKVR
EEWSNFSYFPEITHIVIKESLVSINKQDNKNMELQLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVLGGQKQFKNFQIEVQKGRYSLHGSDRGFPSLEELMSHLKKQILRTDNISFVL
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSG
TLVDYRDDEGTAEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGVDSEIGPFIKLSDPGIPVTVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCLNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKTPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMEYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNALKEGKRLPCPPNCPDEVYQLMRKCWEFQPSSRT
TFQSLIEGFEALLK
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcagtgccatggcgttctgtgctaaaatgagg
agctccaagaaggccgaggtgaaccaggtggcgcccaagccaggggtggaggtgaccttc
tacctgccggaccggggccccctccggctgggcacaggagagtacacagcggaggagctg
tgcatccaggcggcgcaggagtgctgtatctctcctctgtgtcacaacctcttcgccctg
tacgatgagaacaccaagctctggtacgcacccaaccgtgtcatcaccgtcgacgacaag
atgtctctccggctccactaccgcatgaggttctacttcaccaactggcatgggaccaac
gacaacgagcagtcagtgtggcgacactcgccaaagaagcagaagagcagctatgagaag
aggaaggttcccgacgcaaccccgctcctggacgccagctccctggagtacctgttcgcg
cagggacagtacgatctggtcaagtgcctggcgcccatccgggaccccaagacggagcag
gacggacatgacattgagaacgagtgcctgggcatggccgtgctggccatctcgcactac
gccatgatgaagaaggtgcagctgccagagctgcccaaggacatcagctacaagcggtat
attccagaaacgttgaataagtccatcagacagaggaacctcctcacccggatgcggata
aataatgttttcaaggatttcctaaaggagtttaacaacacgaccatctgcgacagcagc
gtgtccacacacgatctcaaggtgaagtacctggccaccttggaaaccttgaccaaacat
tacggggctgaaatattcgagacttccatgttgcggatttcatcagaaaatgagatgaat
tggtttcactcgtctgagggtgcaagcacgctctgctacgaagtgatggtgaccggaaat
ctcgggatccagtggcggcagaaaccaaacgctgttcctgctgaaaaggagaaaaacaaa
ctgaagcggaaaaaactggaaaacaaacacaagaaggatgaggagaaaaacaaagtccgc
gaagagtggagcaacttctcgtacttccccgagatcactcacatcgtcataaaggagtcc
ttggtcagcattaacaagcaggacaacaagaacatggaactgcagctctcttcgcacgaa
gaggccttgtccttcgtgtccctggtggacgggtacttccggctcacggcagacgcccac
cactacctctgcactgatgtggctcctccgctgatcgtccacaacatacagaacggctgc
cacggcccaatctgcacggagtacgccatcaacaagctgcgccaggagggcagcgaggag
ggcatgtatgtgctgaggtggagctgcacggactttgacaacatcctcatgacggtcacc
tgcttcgagaagtccgagcaggtgctgggtggccagaagcagttcaagaacttccagatc
gaggtgcagaagggccgctacagcttgcatggctcggaccgtggcttccccagcctggag
gagctcatgagccacctcaagaagcagatcctgcgcacggacaacatcagcttcgtgctg
aagcgctgctgccagcccaagccccgggaaatctccaacctgctggtggccaccaagaaa
gcccaggagtggcagcccgtctaccccatgagccagctgagcttcgatcggatcctcaag
aaagatatcatgcaaggcgagcacctcggcaggggcacaaggacgcacatctactctggg
acgctggtggactacagggacgacgaggggactgcggaggagaagaggataaaagtgatc
ctgaaagtgctggaccccagccacagggacatctctctggccttcttcgaagcagccagc
atgatgaggcaggtgtcgcacaagcacatcgtgtacctgtacggcgtgtgcgtgcgggat
gtggagaacatcatggtggaggagtttgtcgagggcggccccctggacctcttcatgcac
cgcaagagcgacgtcctcaccacaccctggaagttcaaggttgccaagcagctggccagc
gccctgagttacttggaggacaaagacctggtccatggaaacgtgtgcaccaagaacctc
ctgctggcccgagaaggcgtagacagtgagatcggcccgttcatcaagctcagcgaccca
ggcatccctgtcaccgtgctgtccaggcaagagtgcatcgagcggatcccctggatcgcc
cccgagtgcgtggaggactccaagaacctgagcgtggccgctgacaagtggagctttggc
accaccctctgggagatctgctacaatggcgagatcccgctgaaggacaagacactgatc
gagaaggagaggttctacgagagccgctgccggccggtgacgccatcctgcaaggagctg
gccgacctgatgacccgctgcctgaactatgaccccaaccagaggcccttcttccgtgcc
atcatgagggacatcaacaagctggaggagcagaatccagacatcgtttcagaaaaaaca
ccagccaccgaggtggatcccacgcattttgagaagcgcttcctgaagaggatccgtgac
ctgggagagggccactttggcaaggtggagctctgcaggtacgaccccgagggggacaac
accggggagcaggtggccgtcaagtccctcaagcccgagagcggaggcaatcacatagcc
gacctgaagaaggagatcgagatcctgaggaacctctaccacgagaacattgtcaagtac
aagggcatctgcacggaggatggaggaaacggcatcaagctcatcatggagttcctgccc
tcgggaagcctgaaggagtaccttcctaagaacaagaacaaaattaacctcaagcagcag
ctcaagtacgccgtgcagatctgtaagggcatggagtacctgggctcccggcagtacgtt
caccgcgacctggcagccagaaacgtcctggttgaaagtgagcaccaggtgaagatcggg
gactttgggctcaccaaggccatcgagaccgacaaggagtactacacggtcaaggacgac
cgcgacagccccgtattctggtacgcgccggagtgcctcatccagtgtaagttttacatt
gcctcagacgtctggtctttcggagtgaccctgcacgagctgctcacgtactgcgactcg
gactccagccccatggccttgttcctgaaaatgataggcccgacccatggccagatgaca
gtaaccagacttgtgaacgccctgaaggaaggaaaacgcttgccttgtccgcctaactgc
ccagatgaggtttatcagcttatgagaaaatgctgggaattccagccatccagccggaca
accttccagagccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system