KEGG   Heterocephalus glaber (naked mole rat): 101710340
Entry
101710340         CDS       T02812                                 

Definition
(RefSeq) aldehyde oxidase 2-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00280  Valine, leucine and isoleucine degradation
hgl00350  Tyrosine metabolism
hgl00380  Tryptophan metabolism
hgl00750  Vitamin B6 metabolism
hgl00760  Nicotinate and nicotinamide metabolism
hgl00830  Retinol metabolism
hgl00982  Drug metabolism - cytochrome P450
hgl01100  Metabolic pathways
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101710340
   00350 Tyrosine metabolism
    101710340
   00380 Tryptophan metabolism
    101710340
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101710340
   00760 Nicotinate and nicotinamide metabolism
    101710340
   00830 Retinol metabolism
    101710340
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101710340
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101710340
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101710340
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Fer2_2 Ald_Xan_dh_C CO_deh_flav_C Fer2 DUF1409
Other DBs
NCBI-GeneID: 101710340
NCBI-ProteinID: XP_012923560
LinkDB
Position
Un
AA seq 1355 aa
MPPPLGSDELIFFVNGRKVTERAVDPEVTLLTFLRRKLGLTGTKSACGGGGCGACTVMLS
RHDPASGKPRHFSVTACLVPVCSLHGAAVTTVEGVGSVRSRIHPVQERIAKSHGTQCGFC
TPGMVMSLYTLLRNYPQPSEEQLLEALTGNLCRCTGYRPILESGRTFCSDSGGCGQTEST
RCCLDQPGGDSCPAEDSSLPARMCSELFTRAEFWPLDPTQEPIFPPELMRMAESPERRTL
TFCGDRVTWVSPGTLQELLELRARHPDAPLVLGNTALGPAARPHGGVHPVLLSPARVPEL
SAAADTSAGLTIGAGCSLAQVQDILAKSIAKLPGEKTRTLQALARALRSLAGQQIRNLAS
LGGHVMSQHSYSDLNPILAVGRAALNLRSEGGERVIPLDENFLAGVASAGLRPGEMVESV
HIPHTRKWEFVSGFRQAQAPKNAVPHVSAGLRVLFKEGTDAIEDLSIAYGGVGATTVMAP
RSCQQLLGRHWTEVTLDEACRLVLGEVVVPGSIPGGRAEFRRTLLVSFLFRFYLQVLHEL
RTRWFPGPPSALSDSCWCPKLPDQFLSALEDFPVTVPRGLQTYQSVDPQQPSQDPVGRPI
MHLSGLKHATGEAVFCDDLPRLDRELCMALVTSTRPHAKIVSVDPSKALGLPEVVSVITA
EDIPGTNGTEGDRLLAVDEVLCVGQVICAVVAETDVQAKRAAEEVRVTYEDLQPVIFSIQ
DAIKHSSFLCPEKKLEQGSIEEAFAKVDQVLEGEVHVGGQEHFYMETQRVLVVPKAEDRE
LDIYVSTQDPAHVQKTAASTLNVPLSRVTCHVKRVGGGFGGKVGRPATLGAIAAVGAVKT
GRPVRLVLDREEDMLITGGRHPLFGKYKVGFANSGRIKALDIECYINGGCTLDDSELVTE
FLILKLENAYKIRNLRFRGRACRTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPE
KVREKNMYWAVDKTIYQQAFNPEPLGRCWAECLSRANLKARRAQADAFNQQSHWRKRGIA
AVPMKFSVGFAATSFHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELRVPMS
RLHIQETSTATVPNTVATAASIGADVNGRAVQNACQTLLKRLEPIIKKNSEGTWEDWIDA
AFEQRISLSATGYFRGYKASMDWEKGVGDPFPYYVFGAACSEVEIDCLTGAHRKLRTDIV
MDTGCSLNPAIDIGQVEGAFLQGAGLYTSEELHYSPEGALLSRGPGPHEYKVPTVADVPE
ELNVTLLPSAPERTQLSIYSSKGLGESGMFLGSSVFFAISDAVAAAHRDRGLVEDFTVRS
PATPERVRMACEDRFTEMIPRETPGTAKPWCIPIS
NT seq 4068 nt   +upstreamnt  +downstreamnt
atgcctcccccactgggctctgacgagctgattttcttcgtgaatgggaggaaggtgaca
gagcgggctgtggacccggaggtgaccctgctgaccttcctgcgaaggaagcttggcctc
acaggaacgaagtcagcctgcggagggggaggctgcggcgcctgcacggtgatgctgtcc
aggcacgacccggcctccgggaagcccagacacttctccgtaaccgcgtgcctggtgccc
gtgtgctctctgcacggggcggctgtcaccaccgtggagggcgtggggagcgtcagaagc
aggatccacccggtgcaggagaggatcgccaagagccacggcacgcagtgcggcttctgc
acccccgggatggtgatgtcattatacacactgcttcgaaactacccacagccctcggag
gagcagctcctggaggccctgacagggaacctgtgtcgctgcaccgggtaccggccgata
ctcgagagcggcaggaccttctgctcagactcaggcggctgcgggcagacagaaagcaca
cggtgctgcctggaccagccaggaggcgactcctgcccggcggaggacagcagcctacct
gctcgcatgtgctcggagttgttcaccagagccgagttctggcctctggacccgacccag
gagcccatcttccccccagagctcatgcgcatggcggagagcccggaacgacgcacgctg
accttctgcggggacagagtcacctgggtctcccccgggacactgcaggagctcttggag
ctacgggcacgacaccctgacgccccactggtcctgggcaacacggccctgggccccgcc
gcgaggccccacggcggcgtccacccggtgctgctctcgcccgcccgggtcccggagctg
agcgccgcggccgacacgagcgccggcctgaccatcggtgctggctgcagcctggcccag
gtgcaggacatcctggccaagagcatcgccaagctccccggggagaagactcggacactc
caagccctcgccagggccctgcgcagcctggcgggccagcagatccggaacctggcgtcc
ttagggggccacgtcatgagccagcacagctattccgacctgaaccccatcctcgctgtg
ggccgggcggccctcaaccttcggtcagaagggggcgagagggtgatccccctggacgag
aacttcctggcgggggtggcaagcgccggcctgcggcccggggagatggtggagtccgtg
cacatcccccacacccggaagtgggaattcgtgtccggcttccggcaggcccaggccccg
aagaacgccgtgccgcacgtgagcgccggcctgcgcgtgctgttcaaggagggcacggac
gccatcgaggacctgagcatcgcctacggcggggtgggcgccaccacagtcatggcgcca
cggtcctgccagcagctcctgggcaggcactggacggaggtgacgctggacgaggcctgc
aggctggtgctgggcgaggtcgtcgtccccggctcgatccccggcggccgggcagagttc
aggaggaccctgctggtcagcttccttttcaggttctacctgcaggttctgcatgagctg
aggacacgctggtttcccgggcccccgagcgccctgagcgacagctgctggtgtccgaag
ctcccagaccagttcctcagtgcgctggaggacttcccagtcaccgtgccccggggcttg
cagacataccagagtgtggaccctcagcagccgtcccaagacccggtgggccgccccatc
atgcacctgtccggcctgaagcatgccacgggggaggctgtgttctgtgacgacctcccc
aggctggacagagagctgtgcatggccctggtgacaagcaccaggcctcacgcaaagatc
gtgtcagtggacccgtccaaggccctcgggctccccgaggtggtcagtgtgataacagcc
gaggacatcccaggcaccaacggcactgagggcgacaggctgctggctgtggatgaggtg
ctgtgtgtgggccaggtcatctgtgccgtggtagcagagacagacgtgcaggcgaagcga
gcagctgaagaggtcagggtcacctacgaggacctgcagcccgtcatcttcagcatccag
gatgccataaagcacagctccttcctgtgccctgagaagaagctggaacagggaagcatt
gaggaggcgtttgcaaaagtggaccaagtcctggaaggagaggtgcatgtcgggggtcag
gagcacttctacatggagacgcagagggtgcttgttgttcccaaggctgaggaccgagag
ctggacatctacgtgtccacccaggaccctgcccacgtgcagaaaacagcggcctcgacc
ctgaacgtcccgctcagccgggtcacctgccacgtgaagcgcgtgggcggaggcttcggg
ggcaaggtggggaggccagccacgctcggggccatcgccgcggtgggcgcagtcaaaact
ggccgtcctgttcgtctcgtccttgatcgtgaagaggatatgttaataactgggggaagg
cacccactattcggaaaatataaagtgggctttgcgaacagcggacggatcaaagcgctg
gacatcgagtgctacattaatgggggctgcacgctggacgactccgagctggtcacagaa
tttctcatactaaaactggaaaatgcatacaaaatccgaaacctcaggttccggggccgg
gcgtgcaggacgaatttaccgtccaatacagcattccgtgggtttggcttcccgcaagga
gccctggtaacagagtcgtgcatcacagccgtggcagccaagtgcggccttccgccagag
aaggtcagggagaagaacatgtactgggcggtggacaagaccatctaccagcaggcgttc
aaccccgagcccctgggccgctgctgggctgagtgcctgtcccgggccaacctcaaggcc
cggcgggcgcaggctgacgccttcaaccagcagagccactggaggaagcggggcatcgct
gccgtgcccatgaagttctcggtcggcttcgcggccaccagcttccaccaggcagcagca
ctggtgcacatctacacagacggctctgtgctggtcacccacggtgggaacgagctggga
caggggatccacaccaagatgctccaggtggccagccgtgagcttcgggtccccatgtcc
cggctgcacatccaggagaccagcacggcgaccgtgccgaacaccgtggccaccgccgca
tccatcggcgctgatgtcaacggcagggctgtgcagaacgcctgtcagaccctcctgaag
cgccttgaacccatcattaagaaaaattcagaaggcacctgggaagactggatagacgca
gcatttgaacaaagaatcagtctctcagccactggatactttaggggctacaaggcctcc
atggactgggagaagggggtgggagacccctttccgtactatgtctttggggccgcctgc
tctgaggtcgagatcgactgcctgaccggtgcgcacaggaaactcaggacagacatcgtc
atggacaccggctgcagcctgaacccagccatcgacattggccaggtggaaggcgcgttc
ctccagggcgccggcctctacacctcggaggagctgcactactccccggagggcgccctg
ctgtcccgagggccagggccacatgagtacaaggtccccactgtggccgacgtcccggag
gagcttaacgtcaccctgctgccgtcggcaccagaacggacccagctctccatctactcg
tccaagggcctcggcgagtccgggatgttcctggggtcgtccgtgttctttgccatcagc
gacgcagtggcggcagcgcacagggacaggggcctcgttgaggacttcacagtgaggagc
ccagccacgccagaacgcgtgcgcatggcctgcgaggatcgcttcacagagatgatcccg
agagagacccctggaacagcaaaaccttggtgtatccctatctcatag

KEGG   Heterocephalus glaber (naked mole rat): 101722324
Entry
101722324         CDS       T02812                                 

Gene name
Aox4
Definition
(RefSeq) aldehyde oxidase-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00280  Valine, leucine and isoleucine degradation
hgl00350  Tyrosine metabolism
hgl00380  Tryptophan metabolism
hgl00750  Vitamin B6 metabolism
hgl00760  Nicotinate and nicotinamide metabolism
hgl00830  Retinol metabolism
hgl00982  Drug metabolism - cytochrome P450
hgl01100  Metabolic pathways
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101722324 (Aox4)
   00350 Tyrosine metabolism
    101722324 (Aox4)
   00380 Tryptophan metabolism
    101722324 (Aox4)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101722324 (Aox4)
   00760 Nicotinate and nicotinamide metabolism
    101722324 (Aox4)
   00830 Retinol metabolism
    101722324 (Aox4)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101722324 (Aox4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101722324 (Aox4)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101722324 (Aox4)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2 DUF1409 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 101722324
NCBI-ProteinID: NP_001266810
UniProt: M1ZMN8
LinkDB
Position
Un
AA seq 1336 aa
MLPLSSSDELIFFVNGRKVVEQKPDPEVSLLFYLRRVLRLTGTKFACGEGGCGACTVMVS
RYNAMSKEIHHYPATACLVPVCSLHGAAVTTVEGVGSIRSRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPNPTPEQVTEALGGNLCRCTGYRPIVESGKTFCEPTACPAKGSGR
CCLEQEEEEEPGSPHLREKMCTKLYDRDEFQPLDPSQEPIFPPELIRMAEDPSKRRLTFQ
GARTTWLAAVTLQDLLQLRADFPHAPLVMGNTTVGPDIKFKGEFYPVFISAAGLPELRLV
NSEDGGVIVGAGHSLAQLSDALRSIVSEQPPEKTQTCRALLTALRTLAGAQIRSMATLGG
HVATRATISDLNPILAAGKATIHLISKGERQIPLDSAFLEGSPEASLQPGEVVLSVSIPY
STQWQFVSGLRQAQRHENSMAIVNAGMSVQFEDGTSTIQDLQLFYGGVGPTVVSASRTCR
QLVGRQWDDQTLGEACQGILGEVHLPPNAPGGQVQFRRTLLLSLLFKFYLSVRRGLSRLD
PQKFPDIPEQFMSALEDFPIVTPQGIQMFQCVDPRQPLRDPVGHPVMHQSALKHATGEAV
FVDDMPPLDRELSLAVVTSTRAHAKVTSIDTAEALALPGVVAVITAEDVPGKNNHQGEIF
YAQSEVICVGQIVCTVAADTYAHAREAAKRVQIEYEDIEPRIVTVEQALEHNSFLSPERK
IEQGNVEWAFKHVDQIIEGEVHVEGQEHFYMETQSILAIPGDEDKEMVLHLGTQFPTHVQ
EFVAAALNVPRSRIACHMRRAGGAFGGKVTKPALLAAVAAVAAHKTGHPIRFVLERGDDM
LITAGRHPLLGRYKIGFMKSGLIKAADVQFYINGGCTPDESQLVLEFIVLKSENAYYIPN
FRCRGRACKTNLPSNTAFRGFGFPQATVVVEAYMASVAAHCGLLPEEVREINMYKRTSQT
AYKQTFNPEPLRRCWVECLEQSSFHARKQAAEDFNGCSYWKKRGLAAVPMKFTIGIPIAY
YHQAAALVHIYLDGSVLLTHSGCELGQGLHTKMIQVASRELGIPTSYIHLSETSTVTVPN
AVLTAGSMGTDVNGKAVQNACQTLMGRLQPVIRRNPRGTWEEWIKKAFEESISLSATGYF
RGYQTNMDWDREQGDAFPYYVYGAACTEVEVDCLSGAHKLLRTDIFMDAAFSINPAVDIG
QIEGAFVQGMGLYTTEELKYSPEGMLHSRGTNDYKIPTVSEIPEEFHVTLVHSRNPIAIY
SSKGLGEAGMFLGSSVLFAIADAVAAARRERGLDRTFTLSSPASPEWIRMSCVDQFTDMI
PWDDPSAFTPWATRVS
NT seq 4011 nt   +upstreamnt  +downstreamnt
atgctgcccctctccagttctgacgagctgattttctttgtgaatgggagaaaggtggtg
gagcagaagcccgaccctgaggtcagcctgctgttctacttgcggagagtcttgcgtctc
acaggcacgaaattcgcctgtggagaaggtggctgtggcgcctgcaccgtcatggtgtcc
agatacaacgccatgagcaaggagatccaccactacccagccactgcgtgcctggtgccc
gtgtgctctctgcacggggcggctgtcaccaccgtggagggcgtggggagcatcagaagc
aggatccacccagtgcaggagagacttgccaagtgccacggcacgcagtgcgggttctgc
agccccggcatggtgatgtccatctacacactgcttcggaaccacccgaacccgacgccg
gagcaggtcaccgaggccctgggaggtaatttgtgccgctgcactggataccggccgatt
gtagaaagtggaaaaaccttctgtgagcccactgcctgcccagcaaaggggtcgggaagg
tgctgcctggagcaagaggaggaggaggagccaggctccccacacctgcgggagaagatg
tgcaccaagctgtacgacagggacgagttccagccactggacccctcccaggagcccatc
ttccccccggagctgataaggatggctgaggaccccagcaagaggaggctgacgttccag
ggtgcgaggaccacctggcttgccgccgtgaccttgcaggacctcctgcagctgagagcc
gacttcccccacgccccgctggtcatggggaacacgaccgtgggccccgacatcaagttc
aaaggtgaattctacccggtgttcatctccgctgctgggcttccggagctccgcctggtg
aattccgaggacggtggggtgatcgtaggcgcgggacacagcctggcccagctgagtgac
gccctgcggtccattgtttccgaacaaccgcccgagaagacgcagacctgccgcgcgctg
ctgacggccctgaggacgctggccggggcgcagatcaggagcatggcgactttaggagga
catgtggcgacccgggctaccatttccgacctgaaccccatcctggcagcagggaaggcg
accatccacctgatatccaagggggagcggcagatccctctggacagtgccttcctcgag
gggtcccccgaggccagcctgcagccaggagaggtcgtgctgtctgtctccatcccctac
tccactcagtggcagttcgtgtcggggctccggcaggcccagcggcatgagaactccatg
gctatcgtcaacgccgggatgagcgtgcagtttgaggacggcaccagcaccatccaagac
ctgcagctgttctacggcggcgtggggcccacggtggtctccgcgagccgcacctgcagg
cagctggttggcaggcagtgggacgaccagacactgggggaggcctgccaagggatcctg
ggcgaggtccacctgccccccaacgcccccggtggccaggtgcagttccggcgcacgctg
ctgctcagcctgctcttcaagttctacctgagcgtgcggcggggactgagcagactggat
ccacagaagtttcctgatatcccagaacagttcatgagtgcgctggaagatttccccata
gtaacgccccaaggaatccagatgttccagtgcgtggacccccgccagcccctgcgagac
ccagtcggccacccagtcatgcaccagtcggccctgaagcacgccacgggggaagcggtg
tttgtggacgacatgcctcccctggaccgagaactgtccctggccgtggtcaccagcacc
agggctcacgccaaagtcacatccattgacaccgcagaagccctggcgctcccaggagtg
gtcgcggtgataacagcagaggacgttcccgggaagaacaaccaccagggagagattttc
tacgcacagagtgaggtgatctgcgtgggtcagatcgtgtgcaccgtggccgccgacacc
tacgcgcacgccagggaggcagctaagagagtgcagatcgagtacgaggacatagagccc
aggatcgtcacagtcgagcaagccctagagcacaattcgtttctttctcctgagaggaaa
atcgagcaaggaaatgtggagtgggcctttaaacacgtggaccaaatcattgaaggcgag
gtacacgtggagggccaggagcacttctacatggagacgcagagcatcctggccatcccg
ggggacgaggacaaggaaatggtgttgcacctgggcacccagtttcccacccacgtgcag
gagttcgtggccgcagctctaaatgtcccgaggagcagaatcgcctgccacatgcggaga
gctggaggagcatttgggggcaaggtgaccaagccggccctgctggccgccgtcgctgct
gtggccgcccacaagactggccacccaatccggttcgtgctggagcggggcgatgacatg
ctgatcacggccggccgccatccactcctcggaagatacaagatcggcttcatgaagagt
gggctgatcaaggctgcggacgtgcagttctacatcaatggtggctgcaccccggatgaa
tcccagctggtgctggagttcatcgtgctgaaatcggaaaacgcatattacatccccaac
ttccggtgccggggcagggcctgcaaaacaaacctcccgtccaacactgccttccggggc
ttcggcttcccccaggccaccgtggtggtggaggcctacatggcctcggtggcagctcac
tgtggcctgctccctgaagaggtgagagaaataaacatgtacaagaggacgagtcagaca
gcctacaagcagacattcaaccctgagcccctgcgccggtgctgggtggagtgtctggag
cagtcctctttccacgcccggaagcaggctgctgaggacttcaacgggtgcagctactgg
aagaagagagggctcgctgcggtccccatgaagttcaccatcggcatccccatagcctac
taccatcaggcagcggctctggtccacatctacctggatggctcagtcttgctgactcac
agcggctgtgaacttggacaaggcctgcacaccaaaatgatccaggtggccagccgggag
ctgggcatccccacatcctacatccacctctcggaaaccagcaccgtgacggtgcccaac
gctgtcctcactgcaggctccatgggcacagatgtcaatgggaaggccgtgcagaatgcc
tgccaaaccctcatgggccgtcttcagcccgtcatcaggagaaaccctcgagggacctgg
gaggagtggatcaaaaaggccttcgaggaatccatcagcctctcggccaccggatatttc
agaggctaccagaccaacatggactgggacagggagcagggcgacgccttcccctactac
gtgtacggagcagcctgcaccgaggtcgaggtcgactgcctctccggggcccacaagctc
ctgaggactgacatcttcatggatgccgccttcagcatcaaccccgccgtagacatcggg
cagatcgagggggcctttgtccagggaatgggactgtacaccacggaagaactgaaatac
tccccagaaggcatgctgcattctcggggcacaaatgactacaaaatccccaccgtctcc
gagataccagaagagttccacgtcaccctagtgcactcccgaaaccccatagccatctac
tcctccaagggcctgggcgaggcggggatgttcctgggcagctcggtgctgttcgccatc
gccgatgccgtggccgccgcccgcagggagaggggcctggacaggaccttcaccctgagc
agcccggcgagcccagagtggatccggatgtcgtgcgtggaccagttcaccgacatgatt
ccctgggatgacccttcagcgtttacaccgtgggccacccgcgtgtcctaa

KEGG   Heterocephalus glaber (naked mole rat): 101722898
Entry
101722898         CDS       T02812                                 

Gene name
Aox1
Definition
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00280  Valine, leucine and isoleucine degradation
hgl00350  Tyrosine metabolism
hgl00380  Tryptophan metabolism
hgl00750  Vitamin B6 metabolism
hgl00760  Nicotinate and nicotinamide metabolism
hgl00830  Retinol metabolism
hgl00982  Drug metabolism - cytochrome P450
hgl01100  Metabolic pathways
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101722898 (Aox1)
   00350 Tyrosine metabolism
    101722898 (Aox1)
   00380 Tryptophan metabolism
    101722898 (Aox1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101722898 (Aox1)
   00760 Nicotinate and nicotinamide metabolism
    101722898 (Aox1)
   00830 Retinol metabolism
    101722898 (Aox1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101722898 (Aox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101722898 (Aox1)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101722898 (Aox1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 101722898
NCBI-ProteinID: NP_001297151
UniProt: M1ZMK6
LinkDB
Position
Un
AA seq 1333 aa
MEPLHFFVNGRRVTEKNVDPEMMLLPFLRRNLRLTGTKYGCGGGGCGACTVMISRYDHSA
RRVRHYPASACLTPVCSLHGAAVTTVEGVGSTRTRLHPVQERIAKSHGTQCGFCTPGMVM
SLYTLLRNYPQPSEEQLLAALAGNLCRCTGYRPILDAGRTFCKTSGCCQSKENEVCCLDQ
GVNRLPEPKEGGQMSPKLFSEEEFLPLDPTQELIFPPELMILAEKQPRTPRVFTGDRMTW
ISPVTLEGLLEAKSKFPHAPLVMGNTSVGPEMKFKGVFHPVIISPDGIEELSVIKHACNG
LTLGAGLSLAQMQDVLADVVQWLPEEKTQTFHALLKQLRTLAGSQIRNMASLGGHILSRH
PDSDLNPLLAAGSCTLCVLSKEGERQIPLDEHFLSRSPSADLKPQEVLLSMTVPYSRKWE
FVSAFRQAQRRENAQAIVNAGMRVFFGEGDGVITELSILYGNVGPAAICARDACRKLVGR
SWSEETLDEACRLVLGEVTIPGSAPGGRVEFRRTLLVSFLFRFYLQVSQGLSHMDPGRYP
SLVGKYESALEDLHPEHRHGRGTFRYQNTDPKQLPQDPIGRPVMHLSGVKHATGEAVYCD
DMPAVDQELFLTFVTSSRAHAAIVSMDLSEALSLPGVVDIVTSKHLGDVNSFSTETLLAT
DKVLCVGHLVCAIIADSEVQAKQAAEKVRIVYKDLEPLILTVEEAVQHKSFFEGERKLEC
GDVEEAFKTVDQVLEGEVHMGGQEHFYMETQSMLAIPKAEDQEMDIYVSTQFPKYIQDIV
ASTLKLPANKVMCHVRRVGGAFGGKVIKTSIMAAITAFAAHKHGRAVRCVLERGEDMLIT
GGRHPYLGKYKVGFMNDGRIVALDMEHYNNGGNSLDESLFVLEMGLLKMENAYKFPHLRC
RGRACRTNLPSNTALRGFGFPQAGFVTESCIEEVAAKCGLSPEEVREVNMYKGTKQTPYG
QEINTEGLAQCWRECKAQASFSLRRAAVERFNAGSAWKKRGLAMVPLKFPVGVGSVAMGQ
ASALVHVYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELKMPMANVHLRGTSTETVPNANA
SGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGAWKDWAQAAFDGSISLSAIGYFRGY
ESNIDWEKGQGHPFEYCVYGAACSEVEIDCLTGNHKNIRTDIVMDVGHSINPALDRGQVE
GAFIQGMGLYTSEELKYSPRGSLHTRGPDQYKIPGVCDIPTELHISFLPPSENSNTLYSS
KGLGESGIFLGCSVLFAIRDAVRASRQERCLPGTVALSSPLTPEKIRMACEDRFTKMIPR
DIPGSCVPWDVLV
NT seq 4002 nt   +upstreamnt  +downstreamnt
atggagccgctgcacttcttcgtgaacggccgcagggtgacagagaaaaatgttgatcct
gaaatgatgctgttgccgttcctgaggaggaatctgcgactcaccggcaccaagtacggc
tgcgggggcggcggctgcggcgcctgcaccgtgatgatctcgcgctacgaccacagcgcc
cggagggtcagacactacccagccagtgcctgcctgacgcctgtctgctccctgcacggc
gcagctgtcaccacggtggaaggcgtgggaagcacgaggacgcggctgcaccccgtgcag
gagaggatcgccaagagccacggcacgcagtgtggcttctgcacccccgggatggtgatg
tcgctgtacacgctgctgcgaaactacccacagccctcggaggagcagctcctggcggcc
ctggcaggcaacctgtgccgctgcacggggtacagacccatcctggacgcgggcaggacc
ttctgcaagacttctggctgctgccaaagtaaagaaaatgaggtttgctgtttggaccaa
ggagtaaacagactgccagaacccaaggagggaggccagatgagtccaaagctcttctcg
gaagaggagtttctgccgttggacccaactcaggagctgatatttcctcccgagctgatg
atactggctgagaagcagccgcggaccccccgggtgtttacgggggacagaatgacctgg
atttccccggtgaccctggagggccttctggaagccaagtccaagttcccccacgccccg
ctggtcatgggcaacacctccgtggggcctgaaatgaaatttaaaggtgtcttccacccg
gttataatttctcctgatggaattgaagagctgagtgttataaagcatgcatgcaatggg
ctgactctgggtgctggcctaagcctggcccagatgcaggatgtcctggctgatgtggtc
cagtggctcccagaagagaagacgcagacattccatgctctcctgaagcagctgaggacg
ctggctgggtcccagatcaggaacatggcttctttagggggccacatcttgagcaggcat
ccggactcagatctgaaccccctcttggctgcaggtagctgcaccctctgtgtgctgtcg
aaagagggggaacggcagatcccgctggatgagcactttctcagcaggagccccagcgcg
gatctcaagccccaggaggtcttgctgtccatgactgtcccctactcccggaagtgggag
ttcgtgtccgccttccggcaagctcagcgcagagagaatgcgcaagccatagtgaatgca
gggatgagggtcttctttggggaaggggacggcgtcatcacagagctttccatcctgtac
ggcaatgtcggcccggccgccatctgtgccagggatgcctgccggaagctcgttggcagg
tcctggagtgaagagacgctggacgaggcctgcaggctggtgctgggcgaggtcaccatc
cctggctcggcccctggtggccgggtggagttcaggcggaccctgctggtcagcttcctc
ttcaggttctacctgcaggtgtcccagggcttgagccacatggacccgggtcgctatccc
agcctggtgggcaagtacgagagcgcgttagaagacctccaccccgagcacagacatggc
cggggaacgttcaggtaccagaacacggaccccaagcagcttcctcaggaccccattggc
cgccctgtcatgcacctgtccggggtcaaacatgccaccggggaggccgtctactgcgac
gacatgcccgcggtcgaccaggagctgttcctgacctttgtgaccagctcgagagcccat
gctgctatcgtctccatggatctgtcagaggctctcagcctgccgggcgtggtggacatc
gtgacgagcaagcaccttggggacgtaaactccttctccacagagacattgctggcgaca
gacaaggtgctgtgtgtgggtcaccttgtctgtgccatcatcgcagattctgaggttcag
gcaaaacaagctgctgagaaagtgcgcatcgtctacaaggacctggagccactgatcctc
acggttgaggaagctgtccagcacaagtccttcttcgagggggagaggaaactggagtgt
ggagacgtggaagaggcgttcaagacagtggatcaggttctggaaggtgaggtccacatg
ggtggtcaagagcatttctacatggagactcaaagcatgcttgccattcccaaggcagag
gaccaggagatggacatctatgtgtccacacagttccccaagtacatccaggatatcgtt
gcctcgaccttgaagctcccggctaacaaggtcatgtgccacgtgcggcgtgttgggggg
gcgttcgggggaaaggtgatcaaaaccagcatcatggcagccatcactgcatttgccgcc
cacaagcacggccgcgcggtccgctgcgtcctggagcgaggagaagacatgctgataact
gggggccgacacccttaccttgggaagtacaaggtgggattcatgaatgacggccggatc
gtggcactggacatggagcattacaacaacggaggcaactccctggacgagtccttgttc
gtgctagagatggggcttctgaaaatggagaatgcatacaagttcccccacctgcgctgc
cggggccgtgcctgcagaaccaacctcccgtccaacacggcgctgcgaggctttggcttc
ccccaggcggggtttgtcacagagtcctgcatcgaggaggtggcggccaagtgcggcttg
tccccagaggaggtccgggaggtgaatatgtacaagggcaccaagcagacgccctacgga
caagagatcaacacggagggcctggcccagtgctggcgtgaatgcaaggcccaggcctcc
ttctcgctgcggcgggcggccgtggagaggttcaacgcaggcagtgcctggaagaagaga
ggactggccatggtgcccctgaagttcccggtgggcgtgggcagcgtcgccatgggccag
gcctctgccctggtccacgtttatctggatggctccgtgctggtcacccacggcggcatt
gaaatggggcagggtgtccacacgaaaatgatccaggtggtgagccgggagctgaagatg
cccatggcgaacgtccacctgcgtgggacaagcaccgaaaccgtccctaacgccaatgcc
tcgggggggtccgtggtggccgatcttaacgggctggcggtgaaggacgcctgtcagact
cttctcaaacgcctggaacccatcatcagcaagaatcctcagggggcatggaaggactgg
gctcaggccgcttttgacggaagcatcagcctctcagcgatcgggtacttcaggggttac
gagtcaaacatcgactgggagaagggccaaggccacccctttgagtactgcgtgtacggt
gcggcctgctcagaggtcgagatcgactgcctgacggggaaccacaagaacatccggaca
gacatcgtcatggatgtcggccacagcatcaacccagccctggaccgtggccaggtcgaa
ggcgccttcatccaaggcatgggactgtacacctcggaggagctgaaatactcgccccgg
ggcagtctgcacactcggggccccgaccagtacaagatcccaggcgtctgcgacatcccc
actgagctgcacatctcctttctgcctccatccgaaaactcgaataccctgtattcgtcc
aagggcctgggcgagtctgggatattcctggggtgctccgtgctcttcgccatccgggac
gcggtgcgtgcctcgcggcaggagagatgtctgcctgggaccgtggctctcagcagccca
ctgaccccagagaagatccggatggcctgcgaggacaggttcaccaagatgattccaaga
gacatacctggatcctgtgttccttgggatgtgctcgtttga

DBGET integrated database retrieval system