KEGG   Heterocephalus glaber (naked mole rat): 101710552
Entry
101710552         CDS       T02812                                 

Gene name
Cdkn1a
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04218  Cellular senescence
hgl04630  JAK-STAT signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101710552 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    101710552 (Cdkn1a)
   04066 HIF-1 signaling pathway
    101710552 (Cdkn1a)
   04068 FoxO signaling pathway
    101710552 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    101710552 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101710552 (Cdkn1a)
   04115 p53 signaling pathway
    101710552 (Cdkn1a)
   04218 Cellular senescence
    101710552 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101710552 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    101710552 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101710552 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    101710552 (Cdkn1a)
   05206 MicroRNAs in cancer
    101710552 (Cdkn1a)
   05205 Proteoglycans in cancer
    101710552 (Cdkn1a)
   05203 Viral carcinogenesis
    101710552 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101710552 (Cdkn1a)
   05212 Pancreatic cancer
    101710552 (Cdkn1a)
   05225 Hepatocellular carcinoma
    101710552 (Cdkn1a)
   05226 Gastric cancer
    101710552 (Cdkn1a)
   05214 Glioma
    101710552 (Cdkn1a)
   05216 Thyroid cancer
    101710552 (Cdkn1a)
   05220 Chronic myeloid leukemia
    101710552 (Cdkn1a)
   05217 Basal cell carcinoma
    101710552 (Cdkn1a)
   05218 Melanoma
    101710552 (Cdkn1a)
   05211 Renal cell carcinoma
    101710552 (Cdkn1a)
   05219 Bladder cancer
    101710552 (Cdkn1a)
   05215 Prostate cancer
    101710552 (Cdkn1a)
   05213 Endometrial cancer
    101710552 (Cdkn1a)
   05224 Breast cancer
    101710552 (Cdkn1a)
   05222 Small cell lung cancer
    101710552 (Cdkn1a)
   05223 Non-small cell lung cancer
    101710552 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101710552 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101710552 (Cdkn1a)
   05161 Hepatitis B
    101710552 (Cdkn1a)
   05160 Hepatitis C
    101710552 (Cdkn1a)
   05163 Human cytomegalovirus infection
    101710552 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101710552 (Cdkn1a)
   05169 Epstein-Barr virus infection
    101710552 (Cdkn1a)
   05165 Human papillomavirus infection
    101710552 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101710552 (Cdkn1a)
   01522 Endocrine resistance
    101710552 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101710552
NCBI-ProteinID: XP_004846735
UniProt: A0A0P6JTF1
LinkDB
Position
Un
AA seq 165 aa
MSHPPGDARQVPHSSKACRRLFGPVDSEQLRLDCDALMASCVQEARRRWNFDFVTETPLE
GNFAWERVLGLGLPKLYLSPGPCGGRDDTGGGRRPSPSTALLQGIVAQEDHVDLSLSCTL
VPRSSEPPEESPGAPGTSQSRKRRQTSMTDFYHSKRRLVFCKRKP
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtcacatccacctggggacgcccgccaggtcccgcacagcagcaaggcctgccgccgc
ctcttcggccccgtggacagcgagcagctgcgccttgactgtgacgcgctcatggccagc
tgcgtgcaggaggcccggcgacggtggaacttcgactttgtcaccgagacgccgctggag
ggcaacttcgcctgggagcgcgtgctcggcctggggctgcccaagctctacctgagcccc
gggccctgcggcggccgagatgacactggagggggcaggcggcccagcccctcgactgcc
ctgctgcaggggatagtggctcaggaggaccacgtggacctgtcgctgtcctgcaccctt
gtgcctcggtcttctgagccgcccgaggagtccccaggggcgcctggaacctctcagagc
cgaaaacggcggcagaccagcatgacggatttctaccactccaagcgccgcctggtgttc
tgcaagaggaagccctga

DBGET integrated database retrieval system