KEGG   Heterocephalus glaber (naked mole rat): 101710909
Entry
101710909         CDS       T02812                                 

Gene name
Gadd45b
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04210  Apoptosis
hgl04218  Cellular senescence
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101710909 (Gadd45b)
   04064 NF-kappa B signaling pathway
    101710909 (Gadd45b)
   04068 FoxO signaling pathway
    101710909 (Gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101710909 (Gadd45b)
   04210 Apoptosis
    101710909 (Gadd45b)
   04115 p53 signaling pathway
    101710909 (Gadd45b)
   04218 Cellular senescence
    101710909 (Gadd45b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101710909 (Gadd45b)
   05202 Transcriptional misregulation in cancer
    101710909 (Gadd45b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101710909 (Gadd45b)
   05212 Pancreatic cancer
    101710909 (Gadd45b)
   05225 Hepatocellular carcinoma
    101710909 (Gadd45b)
   05226 Gastric cancer
    101710909 (Gadd45b)
   05214 Glioma
    101710909 (Gadd45b)
   05216 Thyroid cancer
    101710909 (Gadd45b)
   05220 Chronic myeloid leukemia
    101710909 (Gadd45b)
   05217 Basal cell carcinoma
    101710909 (Gadd45b)
   05218 Melanoma
    101710909 (Gadd45b)
   05213 Endometrial cancer
    101710909 (Gadd45b)
   05224 Breast cancer
    101710909 (Gadd45b)
   05222 Small cell lung cancer
    101710909 (Gadd45b)
   05223 Non-small cell lung cancer
    101710909 (Gadd45b)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101710909 (Gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101710909 (Gadd45b)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101710909 (Gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101710909 (Gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101710909
NCBI-ProteinID: XP_004865838
UniProt: A0A0N8EUX0
LinkDB
Position
Un
AA seq 160 aa
MTLEELVTCDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAELLGEPAETQGATEARDLHCL
LVTNPHTDAWKSHGLVEVASYCQESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaggagctcgtgacgtgcgacaatgcggctcagaagatgcagacggtgacc
gccgcggtggaggagctgctggtggccgcgcagcgtcaggaccgcctcactgtgggggtg
tacgagtcggccaagctgatgaatgtggaccccgacagcgtggtcctctgcctcctggcc
attgatgaggaggaagaagatgacatcgccctgcagatccacttcacgctcatccaatcc
ttctgctgcgacaacgacattgacatcgtcagggtgtcgggcatgcagcggctggcagag
ctgctgggagagccggctgagacgcagggtgccaccgaggcccgagacctgcactgcctc
ctggtcacgaacccgcacacggatgcttggaagagccacggcttggtggaagtggccagt
tactgccaggagagccggggcaacaatcagtgggtcccctatatctctctgcaggaacgc
tga

KEGG   Heterocephalus glaber (naked mole rat): 101711314
Entry
101711314         CDS       T02812                                 

Gene name
Gadd45g
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04210  Apoptosis
hgl04218  Cellular senescence
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101711314 (Gadd45g)
   04064 NF-kappa B signaling pathway
    101711314 (Gadd45g)
   04068 FoxO signaling pathway
    101711314 (Gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101711314 (Gadd45g)
   04210 Apoptosis
    101711314 (Gadd45g)
   04115 p53 signaling pathway
    101711314 (Gadd45g)
   04218 Cellular senescence
    101711314 (Gadd45g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101711314 (Gadd45g)
   05202 Transcriptional misregulation in cancer
    101711314 (Gadd45g)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101711314 (Gadd45g)
   05212 Pancreatic cancer
    101711314 (Gadd45g)
   05225 Hepatocellular carcinoma
    101711314 (Gadd45g)
   05226 Gastric cancer
    101711314 (Gadd45g)
   05214 Glioma
    101711314 (Gadd45g)
   05216 Thyroid cancer
    101711314 (Gadd45g)
   05220 Chronic myeloid leukemia
    101711314 (Gadd45g)
   05217 Basal cell carcinoma
    101711314 (Gadd45g)
   05218 Melanoma
    101711314 (Gadd45g)
   05213 Endometrial cancer
    101711314 (Gadd45g)
   05224 Breast cancer
    101711314 (Gadd45g)
   05222 Small cell lung cancer
    101711314 (Gadd45g)
   05223 Non-small cell lung cancer
    101711314 (Gadd45g)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101711314 (Gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101711314 (Gadd45g)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101711314 (Gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101711314 (Gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101711314
NCBI-ProteinID: XP_004851367
LinkDB
Position
Un
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVSAGDEAGTPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctagaagaagtccgcggccaggatacagttccggaaagcacagccaggatgcag
ggcgccgggaaagctctgcacgagctgctgttatcggctcagcgccagggctgcctcacc
gccggcgtctacgagtccgccaaagtcctgaatgtggaccctgacaacgtgaccttctgc
gtgctggccgcagatgaggaggacgagggcgatatcgcgctgcaaatccacttcacgctg
atccaggcgttctgctgcgagaacgacatcgacatcgtgcgcgtgggcgacgtgcagagg
ctggcggcgatcgtgagcgccggcgacgaggcgggcacgccaggcgacctgcactgcatc
ctcatttcgaaccccaatgaggacgcgtggaaggacccagccttggagaagcttagtctg
ttttgcgaggagagccgcagcgtcaacgactgggtacccagcattacccttcccgagtga

KEGG   Heterocephalus glaber (naked mole rat): 101725746
Entry
101725746         CDS       T02812                                 

Gene name
Gadd45a
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04210  Apoptosis
hgl04218  Cellular senescence
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101725746 (Gadd45a)
   04064 NF-kappa B signaling pathway
    101725746 (Gadd45a)
   04068 FoxO signaling pathway
    101725746 (Gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101725746 (Gadd45a)
   04210 Apoptosis
    101725746 (Gadd45a)
   04115 p53 signaling pathway
    101725746 (Gadd45a)
   04218 Cellular senescence
    101725746 (Gadd45a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101725746 (Gadd45a)
   05202 Transcriptional misregulation in cancer
    101725746 (Gadd45a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101725746 (Gadd45a)
   05212 Pancreatic cancer
    101725746 (Gadd45a)
   05225 Hepatocellular carcinoma
    101725746 (Gadd45a)
   05226 Gastric cancer
    101725746 (Gadd45a)
   05214 Glioma
    101725746 (Gadd45a)
   05216 Thyroid cancer
    101725746 (Gadd45a)
   05220 Chronic myeloid leukemia
    101725746 (Gadd45a)
   05217 Basal cell carcinoma
    101725746 (Gadd45a)
   05218 Melanoma
    101725746 (Gadd45a)
   05213 Endometrial cancer
    101725746 (Gadd45a)
   05224 Breast cancer
    101725746 (Gadd45a)
   05222 Small cell lung cancer
    101725746 (Gadd45a)
   05223 Non-small cell lung cancer
    101725746 (Gadd45a)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101725746 (Gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101725746 (Gadd45a)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101725746 (Gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101725746 (Gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101725746
NCBI-ProteinID: XP_004841533
LinkDB
Position
Un
AA seq 162 aa
MTLEEFPAGEQKTERMDTVGDALQEVLSKARSQRSLTVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLGADAGGEGAAQPPDLH
CVLVTNPHASQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 489 nt   +upstreamnt  +downstreamnt
atgactctggaggaattcccggccggagagcagaagaccgaaaggatggacacggtgggc
gatgccctgcaggaggtgctcagcaaagcccggagtcagcgcagcctcaccgtcggggtg
tacgaggcggccaagctgctcaacgtagacccggataacgtggtgctgtgcctgctggcg
gccgacgaggacgacgaccgggacgtcgccctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcgacattctgcgcgtcagcaacccgggccgcctggccgag
ctgctgctactgggcgcggacgcgggcggcgagggcgccgcgcagcccccggacctgcac
tgcgtgctggtgacgaatccgcacgcgtcgcagtggaaggatccggccctgagccagctc
atctgcttctgccgggagagccgctacatggaccagtgggtgccggtcatcaacctgccc
gagcggtga

DBGET integrated database retrieval system