KEGG   Heterocephalus glaber (naked mole rat): 101710975
Entry
101710975         CDS       T02812                                 

Gene name
Ptgdr
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101710975 (Ptgdr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hgl04030]
    101710975 (Ptgdr)
G protein-coupled receptors [BR:hgl04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101710975 (Ptgdr)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 101710975
NCBI-ProteinID: XP_004835864
LinkDB
Position
Un
AA seq 351 aa
MSFYPCNATTSVQSGNSATVGGVLFGTGLLGNLLALGLLARSGLGSCRPRPQRSVFYVLV
CGLTVTDLLGKCLLSPVVLAAYAQNRSLRGLTPAQGKPLCQAFAFVMSFFGLASTLQLLA
MALECWLSLGHPFFYQRHITLRRGALVAPVVGAFSLAFCALPFAGFGDFVQYCPGTWCFI
QMVSGDGSLSVQGYSVLYSSLVALLVLAIVLCNLGAMRNLYTMHQRLRRNTRCCGLRERG
GAGAGQSEAIPHPLEELDHLLLLALMTVLFTMCTLPLIYRAYYGAFKAFQEEPDDLLALR
FLSVISIVDPWIFIIFRTSVFRMFFHKIFIRPLLYRNWNSHFCQTNTESSL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtccttctacccctgcaacgccaccacctcggtgcagagtggcaactccgcgacggtg
ggcggggtgctcttcggcaccggcctcctcggcaacctgctggccctggggctgctggcg
cgctcggggctcgggtcctgccggccgcgcccgcagcgctcggtcttctatgtgctggtg
tgcggcttgacggtcacggacctgctgggcaagtgtctgctgagcccggtggtgctggcc
gcctacgcgcaaaaccggagccttcgggggctgacgcccgcgcagggcaagccgctgtgc
caagccttcgccttcgtcatgtccttctttgggctcgcctcaaccctgcagctcctagcc
atggccctggagtgctggctgtccctggggcatcccttcttctaccagcggcacatcact
ctgcgccggggtgcactcgtggcgccggtcgtgggcgccttcagcctggctttctgcgcg
ctccccttcgcgggcttcggggacttcgtgcagtactgtcctggcacctggtgcttcatc
cagatggtctcgggagacggctcgctgtcggtgcagggctactcggtgctgtactccagc
ctcgtggcgctgctggtgctcgccatcgtgctgtgcaacctgggcgccatgcgcaacctc
tacaccatgcaccagcgcctgcggcggaacacgcgctgctgcggcctccgggagcgcggg
ggggccggcgccggccagagcgaggccatcccgcaccccctggaggagctggaccacctg
ctgctgcttgccctcatgaccgtgctcttcaccatgtgcacccttcctctaatttatcgc
gcttactatggagcatttaaagcattccaagaagagccagatgacctcctagccttgcgt
tttctctctgtgatttcaattgtggacccttggatctttatcattttcagaacgtcagtg
tttcggatgttttttcacaagattttcataagacctcttctgtatagaaactggaacagc
cacttctgccaaactaacacggaatccagtctgtga

DBGET integrated database retrieval system