KEGG   Heterocephalus glaber (naked mole rat): 101711056
Entry
101711056         CDS       T02812                                 

Gene name
Ralbp1
Definition
(RefSeq) ralA binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04014  Ras signaling pathway
hgl05200  Pathways in cancer
hgl05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101711056 (Ralbp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101711056 (Ralbp1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101711056 (Ralbp1)
Membrane trafficking [BR:hgl04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    101711056 (Ralbp1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 101711056
NCBI-ProteinID: XP_004853287
LinkDB
Position
Un
AA seq 660 aa
MTECFLPPPSSPGEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDVLHEPPDT
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KDKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEGPP
LDAPSLRPIFGIPLADAVERTMMHDGVRLPAVFRECVDYVEKHGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEDYEPNTVASLLKQYLRELPENLLTKELLPRFEEACGRAAESEKV
QEFQRLLRELPECNCLLVSWLVVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVL
FTHVQELFGNVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEETNENEEVIN
ILLTQENEILTEQEELLAMEQFLRRQIAAEKEEIERLRAEIAEIQSVVRRKGGRRERRAM
SPPVPSRQQHGRSETEEYSSESESESEDEEELQLILEDLQRQNEELEIKNNHLNQAVHEE
REAIIELRVQLRLLQLQRAQAEEEEEEEEEEPEEPEEPVRPAGVPEAKPSPSRERKETPI
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgaccgagtgcttcctgcccccacccagcagccccggggaacaccgcagggccgagcat
ggcagcgggctgactcggacgcccagctcagaggagatcagccccaccaagttccccggc
ctgtaccgaacgggtgagccctcgccgccccacgacgtcctccatgagcccccggatacc
gtgtctgacgacgagaaggaccatggaaagaaaaaggggaagttcaagaagaaggagaaa
aggactgaaggctatgctgccttccaggaagacagctctggagatgaggccgaaagtcct
tcaaagatgaagaggtccaagggcatccatgtcttcaagaagcccagcttttctaaaaag
aaggataaggattttaaaataaaagagaaacccaaagaagaaaagcataaagaagaaaag
cacaaagaagaaaaacataaagaaaagaagtccaaggacttgacagcagctgatgttgtt
aaacagtggaaagaaaagaagaaaaagaagaagcctatccaggagccggaggggcctccg
ctcgacgcgcccagcctcaggcccatctttgggattcccttggccgacgcggtggagagg
accatgatgcacgatggcgtccggctgccggccgtcttccgggagtgcgtggactacgtg
gagaagcacggcatgaagtgcgagggcatctacagggtttcaggaattaagtccaaggtg
gatgagctgaaagcagcctacgaccgtgaggagtctcccaacctggaagactacgagccc
aacaccgtggccagcctgctgaagcagtacctgcgtgagctcccggagaacctgcttacc
aaagagctcctgccgcgcttcgaggaggcatgtgggagggcggcggagagcgagaaggtg
caggagttccagcgcctgctcagggagctgcccgagtgcaactgcctcctcgtctcctgg
ctcgtcgtgcacatggaccacgtcatcgccaaggagctggagaccaagatgaacattcag
aacatctccatcgtgctcagcccgaccgtgcagatcagcaatcgtgttctatatgtgctt
ttcacgcatgtgcaagagctcttcgggaacgtggtactgaagcaggtgacgaggcccctg
cgatggtccaacatggccacgatgcccacgctgcccgagacccaagccggcatcaaggag
gagatccggagacaggagtttcttttgaattgtttacatcgagatctgcagggtgggata
aaggatttatctaaagaagaaagattatgggaagtacaaagaattttgacagccctcaaa
agaaaactgagagaagctaaaagacaagagtgtgagaccaagatcgcccaggagatagcc
agtctgtcaaaagaggacgtttccaaggaagaaacgaatgaaaacgaggaagttataaat
attctcctcacccaggagaacgagatcctcaccgagcaggaggagctgctggccatggag
cagttcttacgccggcagatcgcagctgagaaagaggagatcgagcgcctgcgtgccgag
atcgctgagatccagagtgtagttcggagaaagggtggcaggcgagagcgccgggcaatg
tccccgcctgtccccagccgccagcagcacggccggagcgagacggaggagtactcgtca
gagagtgagagcgagagcgaggacgaggaggagctgcagctcattttggaggatctgcag
cgccagaacgaggagctggagatcaagaacaaccacctgaaccaagccgtccacgaggag
cgcgaggccatcatcgagctgcgcgtgcagctccgcctgctgcagctgcagcgcgcccag
gccgaggaggaggaggaggaggaggaggaggagcccgaggagcccgaggagcccgtgcgg
ccagcgggcgtcccggaggccaagccctcgcccagcagagagcggaaggagacgcccatc
tga

DBGET integrated database retrieval system