KEGG   Heterocephalus glaber (naked mole rat): 101711183Help
Entry
101711183         CDS       T02812                                 

Gene name
Mgam
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00052  Galactose metabolism
hgl00500  Starch and sucrose metabolism
hgl01100  Metabolic pathways
hgl04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101711183 (Mgam)
   00500 Starch and sucrose metabolism
    101711183 (Mgam)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101711183 (Mgam)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101711183 (Mgam)
    3.2.1.20  alpha-glucosidase
     101711183 (Mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101711183
NCBI-ProteinID: XP_012929967
LinkDB All DBs
Position
Un
AA seq 1831 aa AA seqDB search
MARKKLKKFTTLEIVLSIFLLALFIIAVVLIVLLAKGPVESKGPETTGTPEPGTTSSTTD
SAACPVVDELERINCIPDRPPTQATCDQRGCCWNPQGPISIPWCYYSKNHGYQMEGNLAS
TNAGFTAQLKSLPSSSLFGNDVDNVLLTAEYQTSNRFHFKLTDQTKNRYEVPHEHVQPFN
GNAASSLNYQVEVSKQPFSIKVTRRSNSRVLFDSSIGPLLFADQFLQLSIRLPSANVYGL
GEHVHQQYRHDMNWKTWPIFTRDTIPNRDGTNLYGAQTFFLCLEDASGLSFGVFLMNSNA
MEVALQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPTLPSYWSLGFHLSRYV
YGTLDKMKEVVDRNRAAQLPYDVQHGDIDYMDERKDFTYDPVNYRGFPDFVTELHNNGQK
FVIIVDPAISNNSSSSNPYGPYDRGSAMKIWVNSSDGVNPLIGEVWPGKTVFPDYTNPNC
AVWWTKEFELFYNQVEFDGIWIDMNEVSNFVDGSISGCSTNNLNYPPFTPRVLDGYLFCK
SLCMDAVQHWGQQYDVHNLYGYSMAIATAEAVKTVFPSKRSLIITRSTFAGSGKFAAHWL
GDNTATWNDLQWSIPGMLEFNLFGIPMVGADICGFSLDTSEELCRRWMQLGAFYPFSRNH
NDKGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFYHAHSRGDTVARPLLHEFY
GDSNTWDVHRQFLWGPGLLITPVLEKGAEKMTAYIPDAIWYDYETGGQLERRKQSIEMEL
PGDKIGLHLRGGYIFPTQQPSTTTMASRRNPLGLIIALDENKEAKGELFWDDGESKDTVV
NKIYLFCEFSVTQNHLDVAISQSTYKDPNNLAFQEIKILGTQEPTNVTVKHNGVPTQASP
KVTYDPNLKVAIISEINLVLGEAYTVEWSIKIRDEEKIDCYPDEHGSSAANCTARGCVWE
GSSSPGVPFCYFVNELYSVSNVQYDSQGASADISLKSSLYTNAFPSTPVNPLRLQVTYHK
DEMLQFKIYDPNNNRYEVPVPLNIPEFPSSTSEGRLYDVFIKENPFGIVICRKGTGTVIW
DSQLLGFTFNDMFLRISTRLPSSYIYGFGEMEHRTFRRNLNWHTWGMFSRDQPPGYKMNS
YGVHPYYMGLEEDGSAHSVLLLNSNAMDVTFQPMPALTYRTTGGILDFYVFLGPTPELVT
QQYTEMIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDAMVAAQIPYDVQYSDIDYMERH
LDFTLRPKFSGFPALINRMKAHGMRVILILNPAISGNETQPYPAFTRGVDDDIFIKYPND
GGIVWGKVWPDFPNVVTDPSLDRKRQVEQYRAYVAFPDFFRNSTVLWWKREIQELYTNPR
NPEKSLKFDGMWIDMNEPSSFVNGAVPSGCTDTTLNRPPYMPYLVARDSGLSSKTLCMES
EQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWAGHWLGD
NTAVWDQLGKSIIGMMEFSLFGISYTGADICGFSQNAEYEMCARWMQLGAFYPFSRNHNN
IGTRRQDPVSWDAAFVNISKSVLETRYTLLPYLYTLMHKAHTEGATVVRPLLHEFVSDRV
TWDIDSQFLLGPALLVSPVLKPNARNVSAYFPGARWYDYYTGVDINARGQWKDLAAPLDH
INLHVRGGYILPWQEPALNTNLSRQNFMGFKVALDDARTAEGWLFWDDGQSIDSYGKGHY
YLARFSVSQNTMQSHVIFNNYIRASNPLKLGYIEIWGMGNVSISSVTISVSNVDITVPVS
YNPTTQVLSIDVTSRSISLHDFVSLTWRCSL
NT seq 5496 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaaaaatttactacactggagattgtgctcagcatttttttg
cttgcattgttcatcattgctgttgttctaattgttcttttagccaaaggtcctgtggaa
tcaaaaggtcctgagacaactggtaccccagagcctgggacaacaagttccaccactgat
tctgctgcgtgcccagtggtagatgaattggaacggataaactgcatccctgaccggcca
ccaacacaggccacatgtgaccagcgtggctgctgctggaaccctcagggacccataagt
attccttggtgctactattccaagaatcatgggtaccaaatggagggcaatcttgcaagc
acaaatgcaggattcacagcccagttgaaaagtctgccttcttcatccttgtttggaaat
gatgttgacaatgtccttctcacagcggaataccagacatctaaccgctttcactttaag
ttgactgaccaaaccaaaaacaggtatgaagtaccccatgaacatgtacagcccttcaat
gggaacgctgcctcttccttgaactatcaagttgaggtctccaaacagccatttagcatc
aaagtgaccagaagaagcaacagtcgtgttctgtttgactcaagcattgggcccctcctg
tttgcagaccaatttctgcagctctccatccgcctgccaagtgccaatgtgtatggtctg
ggggaacatgtccaccaacaatacaggcatgacatgaactggaagacttggcccatattt
accagggacacaattcccaatagggatggaactaacttgtatggtgctcagacattcttc
ctgtgccttgaagatgctagtggattatcctttggggtgtttctgatgaacagcaatgcc
atggaggttgccctccagccagccccagcaatcacttaccgcaccactgggggcattctt
gacttctacgtgttcttgggaaacactccagagcaagttgttcaagaatatctagagctg
attggacggccaaccctgccttcatactggtcactaggatttcacctcagtcggtatgtt
tatggaacattggataagatgaaagaagttgtggacagaaaccgtgcagcacaactccct
tatgatgttcaacatggtgatattgattatatggatgagaggaaggacttcacttatgat
ccagtgaactatagaggtttccctgattttgttacggagttacacaataatggacagaaa
ttcgtcatcattgtggatccagccatctccaacaactcttcctcaagtaatccctatggc
ccatatgaccggggttcagcaatgaagatatgggtgaatagttcagatggagtgaatcca
ctcattggggaggtctggcctggaaaaactgtgtttcctgattacaccaatcccaactgt
gctgtttggtggacaaaggaatttgagcttttctacaatcaagtggagtttgatggaatc
tggattgatatgaatgaagtgtccaactttgttgatggttcaatctcaggatgttccaca
aacaatctcaattatccaccattcactccccgagtcctagatgggtacctgttctgcaag
agtctctgcatggatgcagtgcagcactggggccaacagtatgatgtccacaacctgtat
ggctactctatggcgattgccacagcagaagctgtcaagactgtgtttccaagcaagaga
agcctcatcataactcgttctactttcgcgggatctggcaagtttgcagcccattggtta
ggagacaatacagccacctggaacgaccttcagtggtccatccctggcatgcttgagttc
aacctttttggtatcccaatggtgggtgcagacatttgtggcttttcgttggatacctct
gaggagctctgcaggcggtggatgcagctgggagcattttatccattttccagaaatcac
aatgacaaaggcttcaaggaccaggaccctgcctcctttggagctgactccttgctgttg
aattcctccaggcactaccttaacatccgatatactctattgccttacctctacacactc
ttctaccatgctcacagccggggggacacagtggccaggccccttctgcatgagttctat
ggagacagcaacacttgggatgtgcaccgacagtttttatgggggccaggcctcctcatc
actccagttctggaaaagggtgcagagaaaatgacagcatatattcctgatgctatctgg
tacgactatgagactgggggccaattggaacggagaaaacaaagcatcgagatggaactt
cctggagacaaaatcggacttcatcttcgaggaggctacatcttccccacacaacagcca
agtacaaccactatggccagtcggcggaatcctttgggtctcatcattgccttggatgag
aacaaagaagcaaaaggggagctcttttgggatgatggggaatccaaagacactgtggtc
aataaaatttaccttttttgtgagttttctgtcacccaaaaccacctggatgtggcgatt
tctcagtcaacctacaaggatcccaataacttagcatttcaggagattaaaatacttggg
acacaggaaccgacgaatgttacagtgaaacacaatggtgttccaactcaggcttctcct
aaagtcacttatgatcctaacctgaaggttgctattatctcagaaattaatcttgttctg
ggagaagcatacacagtggagtggagcataaaaataagggatgaagaaaaaatagactgt
taccctgatgagcatggctcttctgcagcaaactgcactgcccggggctgtgtctgggag
ggatccagttctcctggggtccctttttgctattttgtcaacgagctgtactctgtcagc
aacgttcagtatgactcacagggggccagtgctgacatctccttaaagtcttctctttac
accaacgccttcccctccacccctgtgaaccccctccgcctgcaagtgacctaccataag
gatgaaatgctgcagtttaagatttatgaccccaacaataatcgctatgaagtcccagtc
cctctgaacatacccgagtttccatccagcacctctgagggtcgactgtatgatgtcttc
attaaggagaatccatttgggattgtgatttgccggaagggtacaggcacggtaatttgg
gactctcagctcctgggcttcaccttcaatgacatgttcctccgcatctccacccgcctg
ccttcctcctacatctatggttttggggaaatggagcacagaacctttaggagaaacctg
aactggcacacatggggcatgttttcccgggaccagccccccgggtacaagatgaattcc
tatggtgtccacccctactacatgggactcgaggaggacggcagtgcccacagtgtgctc
ctgctgaacagtaatgccatggatgtgacattccagcccatgcctgccctgacataccgc
accacagggggaattctggacttttatgtgttcttgggcccaactccggagcttgtcact
cagcagtacactgagatgattggtcggcctgtgatggtgccttactggtccctggggttc
cagctgtgtcgctatggatacgagaatgacactgagatcgccaacctgtatgatgccatg
gtggccgcccagatcccctacgacgtgcagtattcagacattgactacatggagcgtcac
ctggacttcaccctcaggcccaagttttctgggtttccagctctgatcaatcgcatgaag
gctcatgggatgcgggtcatcctcattctgaacccagccatttctggcaatgagacccag
ccctaccctgccttcactcggggcgtggatgatgacatcttcatcaagtacccaaatgat
ggaggcattgtctggggaaaggtctggcctgatttccccaatgttgtcactgacccgtct
ttagacaggaagcgtcaagtggagcaataccgagcttatgtagccttcccagactttttc
cgcaactcaactgtcttgtggtggaagagagaaatacaagagctgtacaccaatccacgg
aatccagagaagagcttgaagttcgatggcatgtggattgatatgaatgaaccatcgagc
tttgtgaacggggctgtcccttcaggatgcacagatacaactctgaaccgacctccctac
atgccatatttggtggccagggacagtgggctaagcagcaagaccctgtgcatggagagt
gagcagatcctcccagatggctccagagtgcgtcactacgatgtgcacagcctgtatgga
tggtcccagaccaggcccacgtacgaagctgtgcaggaggtgacaggacagcgaggaatt
gtcatcacccgctccacattcccctcttctggccgctgggcaggacactggctgggagac
aacacggctgtgtgggaccagctggggaaatcgatcattggcatgatggagttcagcctc
tttggcatatcctataccggggcagacatctgtgggttctctcaaaatgccgaatatgag
atgtgtgctcgctggatgcaactgggggccttttaccccttctccaggaaccacaacaac
attggcaccaggagacaagaccctgtgtcctgggatgctgcctttgtgaacatttccaaa
agtgtgttggagaccagatacaccctgttgccgtacctctataccttgatgcacaaggcc
cacacggagggcgccactgttgtgagacctcttctccatgagtttgtgtcagaccgggtg
acctgggatatagacagtcagttcctgctgggtcctgccttactggtcagccctgtcctg
aagcctaatgcgagaaatgtcagtgcatatttccctggagcccgctggtatgattactac
acaggtgtggacattaatgcaagggggcagtggaaggacttggcagcccctctggaccac
attaatcttcatgtgcgtgggggctacatcctgccctggcaggagcctgcattgaacacc
aacttgagccgtcagaatttcatgggcttcaaggtggccttagatgatgcaagaactgct
gaaggatggcttttctgggatgatgggcagagcattgattcctatggaaaaggacactat
tatttggccagattttctgtcagccagaatacaatgcagagccatgtaatttttaacaat
tacatcagagcttcaaaccctttgaaactgggctacattgaaatctggggaatgggcaac
gtctccattagcagtgtgaccatctctgtgagcaacgtggatataacagtccctgtcagc
tacaaccctacaacacaggtgttaagcatcgatgtgaccagcagaagcattagcctgcat
gatttcgtttcactgacatggagatgctctctgtaa

DBGET integrated database retrieval system