KEGG   Heterocephalus glaber (naked mole rat): 101711548Help
Entry
101711548         CDS       T02812                                 

Gene name
Mgam2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00052  Galactose metabolism
hgl00500  Starch and sucrose metabolism
hgl01100  Metabolic pathways
hgl04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101711548 (Mgam2)
   00500 Starch and sucrose metabolism
    101711548 (Mgam2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101711548 (Mgam2)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101711548 (Mgam2)
    3.2.1.20  alpha-glucosidase
     101711548 (Mgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101711548
NCBI-ProteinID: XP_012929911
LinkDB All DBs
Position
Un
AA seq 2185 aa AA seqDB search
MAKKFTVLEVLLIIFILIAVVADILLLFLLLEEPSDSSFTPECPKLPQCERIDCTPHHAV
TEDICRRQYKCCWDPVADTNAPKCFFPRNWGYEVSSGLRNTSTGFTAQLKKVPSPSLFGN
DVTDALFTAEFQTSNRFRFKITDANEIRYEVPHENIKPSNGTADTSGLSYHIEVTNKPFS
IKVMRMSNKKVLLDTGIGPLQFAYQYLQLSFRLPSTYVYGLGEHVHQQYHHNMSWKAWPI
FTRDATPTAGLINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVALQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPAYWSLGFQLSRRNYGGINGLKEVVNRNREAGI
PYDVQYSDIDYMDGKKVFTIDEQAYYNLSGFAEELHNNGQKYIIIMNPGIFKDPNYMTYN
NGSIKRVWILESKGFAVGQGYPGKVVFPDFSNPVCTQWWTEQFTDFHNHLKFDGVWIEMD
EVSSFLQDSDQQCESNILNFPPFTPNILDGLLSARTLCMDTEFHRGFHYDVHSLYGYSMA
RATDVAMDTIFPSTRNFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGI
PMIGANICGYTRNVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGFDSLLLSSSRH
YLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDTMTWKVHEQFLWGPGLLITPVLY
EGVDRVKAYIPDAIWYDYETGMAVQWRKQFVDMLLPGDRIGLHLRGGYIFPTQQPNTTTE
TSRKNSLGLIVALDYKREAKGELYWDDGVAKDAVAEKKYILYDFSISSNHLQARITHNNY
MDPNNLMFTDIRILGMDKEPTNFIILSNNAPTPISSIVYNASVQMVTISDLKGLFLGQEF
SIEWKLPVSDLEKFSCYPEDSFASEESCRQWGCLWEHTTTPGVPVCFYDTIPRYAASNIQ
YLRTGITTDLIFLVTPTSAQVAAAPLSPAAASVVSGPLSVEISSLKLSVVYHTENMLQVK
IYDSTNKRYEVPVPLNTPPSPVDSLKNCLYDVRIQTTPFGIQVLRKSSGTVIWDSQLPGF
TFNDMLLSISTRLPSQYIYGFGETEHMTFRRNMSWNMWGMFARDEPPGYKRNSYGVHPYY
MALEEDGSAHGVLLLNSNAMDVTLQPTPALTYRTVGGILDFYMVLGPTPELVTQQYTELI
GRPAMIPYWALGFQLSRHGYQSDSEISSLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSP
SFQNLGILIEQMKKNGTRFILILDPAISGNETHYLTFTRGQEDNVFIKWPDTNDVVWGKV
RPKVYVLLLQLYRAHVAFPDFFCNSTTTWWKKEIQELYANPREPAKSLKFDGLWIDMNEP
SNFMDGSVEGCHNEVLNNPPFMPCLASRDRGLSSKTLCMESEQILPDGSRVRHYDVHSLY
GWSQTRPTYEAVQDTTGQRGIVITRSTFPSSGRWAGHWLGDNTAAWDQLGKSIIGMMQFS
LFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEMFS
RKVLQTRYTLLPYLYTLMHKAHAEGSTVIRPLLHEFTDDRSTWNIDHQFMLGPAVLVSPV
LQSNTFEIWAYFPRARWYDYSTESGHESTGVWEILKAPLDHINLHVRGGYILPWQEPAIN
THFSRQNFMGLTVALDDDGKAEGQMFWDDGQSIDTYENGNYFLANFTAAENILHIQVIHN
KYLSDSNPLKVGYIKVWGVNSTYVTQVKFTYDNQQFTETNLKSDPSNQTLTIQLTDKNIN
LEKLTEVIWIHDDPVVTSPTMTSTSTMSTHPFPSTTEATSAETIISSGSASTTVSTITMV
SITNTPSASSAHVTTTPVIPDTTPFHTSTTTTMTTSPSITGPMSTIPFPKNATNVTTSTP
APGITTPFPSTVSTSAVVPVTTIPFPTNISSVISSASPDTTPFTTNVSTSTTIPLSTIPF
PTNTTNVTSSTIALGTTPFPTNMSTSTTIPLSTIPFPTNTTDVTASTPAPDITTPFPSTM
STSAVVPVTTIPFPTNISSVTTSTIAPDTTPFPTTVRTGTIVSLSTIPFPTNTTNVTTST
TASDSTPLPTTVSTSTTVPLSTIPFPTNTTNVTTSTNAPDTAPFPTTVNSNTTVPLSTIP
FPTNITNVTTSTTVLVKYTLNFPIM
NT seq 6558 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagttcactgtcttagaagtccttctgatcatcttcatcctgattgctgta
gttgcagacatcctgttgctgtttcttcttttggaggaaccttcagattcttcatttact
ccagagtgccccaagctccctcagtgtgaaaggatagactgcacacctcaccacgcagtg
acagaggatatctgcaggaggcagtataagtgctgttgggatcctgtggcagataccaat
gctcctaagtgcttcttccccaggaactggggttatgaagtcagcagtggccttagaaat
acaagcacagggtttactgcccagttgaaaaaagtgccatccccatctttatttggaaat
gatgtaactgatgccctcttcactgccgaatttcagacatccaatcgttttcgctttaag
attactgatgccaatgagattcgttatgaggtaccccatgaaaacatcaagcccagtaat
ggaactgctgatacctccggtttgagctaccacatagaggtcaccaataagcccttcagc
atcaaagtaatgaggatgagcaacaaaaaagtcttgttggacacaggcattgggccgctc
cagtttgcctatcagtacctgcagctatctttccgcctgcccagcacctacgtgtacggg
ctgggggagcacgtgcaccagcaataccaccacaacatgagctggaaggcctggcccatc
ttcacacgggacgcgacccccaccgcgggcctgatcaatctatatggagcacatacattc
ttcttgtgccttgaggataccagtggcttctcttttggagtttttctgatgaacagtaat
gccatggaggttgcccttcagcctgctcctgcaatcacttaccgaacaattggaggcatt
cttgacttttatgtgttcctgggaaacactccagagcaagtagttcaggaatacctggag
cttgttgggcgaccatttttgcctgcctactggagtcttgggttccagcttagccgcagg
aattatggtggcatcaatggattgaaggaggttgtaaaccgaaatcgtgaagctggaatc
ccctatgatgtccagtactcagacatagactacatggatggaaagaaagttttcactatt
gatgaacaagcttactacaacctttcaggttttgccgaagaattacataacaatggacag
aaatatataattatcatgaatcctggcatctttaaggaccctaactacatgacttacaac
aatggaagcataaagagagtgtggatcttggaaagtaaaggctttgcagttgggcaggga
tatccggggaaggtagtctttcctgatttcagcaatccagtgtgtactcagtggtggaca
gagcaattcactgactttcataaccacctgaagtttgatggagtgtggattgaaatggat
gaagtctctagttttctccaagattctgatcaacagtgtgaatcaaacatcttgaacttt
cctccttttactcccaacattctggatggcttactgtctgcaagaaccctctgcatggac
acagagtttcatcggggctttcactatgatgtccacagcttgtatggctattccatggca
agagctacagatgtggccatggataccatctttcccagtaccaggaacttcatcttatct
cgctcaactttcgctggatctggcaaatttgctgctcattggctgggagacaatgcagcc
acatgggatgaccttcggtggtcaatacccagtattcttgagttcaacttgtttggtatt
cccatgataggtgctaacatctgtggttacacaagaaatgtcacagaggagctctgcaga
aggtggatgcagctaggagcattttatccactatcaaggaatcacaatgggcctggtttc
cgtgaccaggacccagctgcctttggttttgactctctgctgttgagctcctccaggcat
tatctgaatatccgttacacactgttgccctatctctacaccctcttttatcgtgctcac
accctgggggagacggtagcaaggcccttggtacatgagttctaccaggatacaatgaca
tggaaggtgcatgagcagttcttatgggggcctggactcctcatcacgcctgttttatat
gaaggtgtggaccgtgtgaaagcatacataccagatgccatctggtatgactatgagaca
ggaatggctgtccaatggaggaaacagtttgtggatatgcttctccctggtgacaggata
ggactccaccttcgagggggctacatattccctacccagcaaccaaacacaaccacagag
accagccggaagaattctctgggactaattgttgccttggactataagagagaggcaaag
ggagagctgtactgggatgatggtgtagctaaagatgctgtagctgaaaagaagtatatt
ctgtatgatttctctatttcctctaaccatctacaggcaaggattacacacaataattac
atggaccccaacaacctcatgtttacagatatcagaatcttgggaatggacaaggagcca
actaactttattatcttatctaacaatgctcccacccccatttcgagcattgtctataat
gcttcagtacagatggtgaccatcagtgatctcaagggactgtttctggggcaagaattc
tctattgaatggaagcttccagtcagtgacctagagaagttcagctgctacccagaggat
tcttttgcttctgaggagagctgtaggcagtgggggtgcctttgggagcacacgactact
cctggtgtgcctgtctgtttctatgacaccatccctcgctatgctgccagtaacatccag
tacctgcgcacaggcatcaccactgacctgatcttcctagtgaccccgacatctgcacaa
gttgcagcagctccactgtcaccagcagcagcctctgttgtctctggtcctctttctgta
gagatcagttccctcaaactgagtgtggtctaccacacagagaacatgctgcaggtcaag
atctatgattccactaataaaaggtatgaggtcccagtacctctgaacacacctccctca
ccagttgactccctcaagaactgcctgtatgatgtcaggattcagaccactccttttgga
atccaggttcttcgcaaaagctccgggactgtgatttgggattctcaactccctggcttc
accttcaacgacatgctcctttccatttccactcgcctcccctctcagtacatctatggc
tttggggaaactgagcacatgacgttcagaagaaacatgagctggaatatgtgggggatg
tttgcccgtgatgagccaccagggtacaagaggaattcctatggtgtccacccctactac
atggcattggaagaggacggcagtgcccatggagtgctcctgctgaacagtaatgccatg
gatgtgacactccagcccactcctgccctgacataccgcactgtaggagggattttggac
ttttatatggttttgggaccaactcctgagcttgtaactcagcaatacactgagttgatt
ggtcggccagcaatgattccatactgggccttgggattccagctgagtcgccatggatac
cagagtgattctgaaatctccagtttgtatgatgcaatggtggcagcccagattccttat
gatgtgcaacatgtagacatcgattacatggaccggaagctggacttcaccctcagcccc
agctttcaaaaccttggtatcctgattgagcaaatgaagaaaaatggcacaagatttatt
ctcattctggacccagccatttctggaaatgaaacacattatctcacattcactagagga
caggaagacaatgtgttcattaaatggcctgacaccaatgatgttgtctggggaaaggta
agacccaaagtgtatgtgttactcttgcagctctaccgggcccacgttgcttttcctgac
ttcttttgtaatagcacaactacatggtggaagaaggaaatacaagagctctatgcaaac
ccccgagaaccagcaaagagcttgaagtttgatggattgtggattgatatgaatgagcca
tcaaactttatggatggatctgttgagggctgccacaatgaagttctcaataacccaccc
tttatgccatgtttggcatctagggacagaggcctgagcagcaagaccctgtgcatggag
agtgagcagatcctcccagatggctccagagtgcgtcactacgatgtgcacagcctgtat
ggatggtcccagaccaggcccacctatgaggctgtgcaggacacgacaggacagcgagga
attgtcatcacccgctccacattcccctcttctggccgctgggcaggacactggctggga
gacaacacagctgcatgggaccagctggggaaatcgatcattggcatgatgcagttcagt
ctctttggaatatcttatacaggagcagatatctgtgggttctttggagatgctgaatat
gagatgtgtgttcgctggatgcaactgggggccttctatccattttctaggaaccacaac
accattggaaccaggagacaagatcctgtggcctggaactcaacctttgagatgttctca
agaaaagtcctgcagactaggtacaccctgctgccttatctctacaccttgatgcacaaa
gctcacgctgagggcagcactgtcattcgacccctcctgcatgagtttacagatgacaga
tcaacttggaatatagaccatcagttcatgttgggccctgctgtcttggtcagccctgtg
ctgcaaagtaacacttttgagatctgggcttatttccccagagcccggtggtatgactac
agcacggaatctggccatgaatctacaggtgtttgggaaatactgaaggctcccctcgac
cacattaaccttcatgtcagaggaggctacattctgccttggcaagagcctgctattaac
actcatttcagtcgacaaaattttatgggattgactgttgctttagatgatgatgggaaa
gctgaaggtcagatgttctgggatgatggacaaagcattgatacatatgaaaatggaaac
tacttcctggcaaactttacagcagctgagaatatcttgcatatccaagtcatacacaat
aagtatttaagtgactcaaatcctctgaaagttggctatattaaggtttggggtgtgaac
tctacttatgtgacacaagtcaaattcacctatgacaaccagcaattcacagagaccaac
ttgaagagtgacccttccaatcagacactaactattcaattaactgacaagaatatcaac
ctggaaaaattaactgaagttatttggattcatgatgatcctgtagttaccagtccaact
atgacaagcaccagcaccatgagtactcatccatttccatctactactgaggctaccagt
gctgagactatcatcagttctggtagtgcaagtacaacagtgagcactatcaccatggtt
tcaatcacaaacacaccttctgcaagttctgctcatgttaccactactcctgttattcct
gatactactcccttccatacaagtaccactactacaatgactactagccctagtattaca
ggtcctatgagcaccattcctttcccaaaaaatgctacaaatgtcaccacaagtactcct
gcccctggtataactactcctttcccttccactgtgagcaccagtgctgttgttcctgtc
actaccattcctttcccaacaaatatttccagtgtcatttctagtgcttcccctgatacc
actcctttcaccactaacgtgagcactagtactactattcctctcagtaccattcctttc
ccaacaaataccacaaatgtcaccagtagcactattgctcttggtactactcctttcccc
actaacatgagcactagcactactattcccctcagtaccattcctttcccaacaaatact
acagatgtcactgcaagtactcctgcccctgatataactactcctttcccttccaccatg
agcaccagtgctgttgttcctgtcactaccattcctttcccaacaaatatttctagtgtc
accactagtactattgcccctgatactactcccttccccactacagtgagaactggtact
attgtttctctcagtactattcctttcccaacaaatactacaaatgtcaccactagtact
actgcctctgatagtactcccctccccactactgtgagcactagtactactgttcccctc
agtaccattcctttcccaacaaatactacaaatgtcaccacaagtactaatgcccctgat
actgctcctttccccactactgtgaatagtaatactactgttcctctcagtaccattcct
ttcccaacaaatattacaaatgtcaccactagtactactgtcctggtcaagtatactctg
aacttccccatcatgtaa

DBGET integrated database retrieval system