KEGG   Heterocephalus glaber (naked mole rat): 101712139Help
Entry
101712139         CDS       T02812                                 

Gene name
Gsto1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00480  Glutathione metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01524  Platinum drug resistance
hgl05200  Pathways in cancer
hgl05204  Chemical carcinogenesis
hgl05225  Hepatocellular carcinoma
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101712139 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101712139 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    101712139 (Gsto1)
   00983 Drug metabolism - other enzymes
    101712139 (Gsto1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101712139 (Gsto1)
   05204 Chemical carcinogenesis
    101712139 (Gsto1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    101712139 (Gsto1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101712139 (Gsto1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    101712139 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hgl02000]
    101712139 (Gsto1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101712139 (Gsto1)
Transporters [BR:hgl02000]
 Other Transporters
  Pores ion channels [TC:1]
   101712139 (Gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101712139
NCBI-ProteinID: XP_004866561
UniProt: G5C8J3
LinkDB All DBs
Position
Un
AA seq 239 aa AA seqDB search
MAARSLSAGSPPPGPVPAGGLRVYSMRFCPYAQRTLLVLEAKGIGHEVVNINLKSKPEWF
FKKNPLGLVPVLENSQGQLICESVITCEYLDEVYPGKKLLPDDPYEKACQKMTFELFSKV
PSLLFRVFMLQQSKGDYSDIKEELKNELNKLEEVLTKKRTTFLGGSSVSMIDYLIWPWFE
RLEVMELQECVDKTPKLKLWMAAMREDPAVKALLLDRKIYQNFVRLYMENSPEAYDCGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcggagcctctctgcaggcagcccgcccccgggcccggtccccgccggcggg
ctgcgcgtctacagcatgcgcttctgcccgtacgcccagaggacgctgctggtgctggag
gccaaagggatcgggcatgaagtcgtcaacatcaacctgaaaagtaagcccgagtggttc
tttaagaagaatccccttggtctggtgccagtgctggaaaacagccagggccagttgatc
tgtgagtctgtcatcacatgtgaatacctggacgaagtgtatcccgggaagaagctgctg
ccagatgacccttatgagaaagcttgccaaaagatgacctttgagttgttttctaaggtg
ccatctttgttattcagggttttcatgctacagcaaagtaaaggagactactctgacata
aaagaggaattgaagaacgaactgaacaagctagaagaggttctgactaagaagaggaca
accttccttggtggcagttctgtctctatgatcgattacctcatctggccctggtttgaa
cggctggaagtaatggagctccaagagtgtgtggacaaaactccaaaacttaagctctgg
atggcagccatgagggaagatcctgcagttaaagccctcctcttggataggaagatctat
caaaatttcgtcagactttacatggagaacagtcctgaagcctacgactgtgggctctga

DBGET integrated database retrieval system