KEGG   Heterocephalus glaber (naked mole rat): 101712201Help
Entry
101712201         CDS       T02812                                 

Gene name
B3galt1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hgl01100  Metabolic pathways
Module
hgl_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101712201 (B3galt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101712201 (B3galt1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     101712201 (B3galt1)
Glycosyltransferases [BR:hgl01003]
 Glycan extension
  Type 1 chain
   101712201 (B3galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 101712201
NCBI-ProteinID: XP_004857665
UniProt: G5ALH1
LinkDB All DBs
Position
Un
AA seq 326 aa AA seqDB search
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFEGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcctgcttatatgtgttgactgttgtgtgctgggccagtgctctc
tggtatctgagtataactcgtcccacttcatcctacactggctctaagccattcagccac
ctaacagttgcaaggaaaaacttcacctttggcaacataagaactcgacctataaaccca
cattcttttgaatttcttataaatgagcccaacaaatgtgagaaaaacattcctttcctt
gttatcctcatcagcaccacccacaaggaatttgatgcccgccaggctatccgggagaca
tggggggatgagaacaactttgaagggatcaagatagccactctcttcctcctgggcaag
aacgcagatcctgttctgaatcagatggttgagcaagagagccagatcttccacgacatc
attgtggaggacttcatcgactcctaccacaacctcaccctcaaaacattaatggggatg
agatgggtggccactttttgttcaaaagccaagtatgtcatgaaaacggacagtgacatt
tttgtaaacatggacaaccttatttataaactcctgaaaccctccaccaagccaagaagg
aggtattttactggctatgtcatcaatggggggcctatccgggatgttcgcagtaagtgg
tacatgcccagggatttgtaccctgacagcaactacccacctttctgttcaggcactggc
tatatcttctcagccgatgtggctgaactcatttataagacctcactccacacaaggctg
cttcaccttgaagatgtatacgtaggactctgtcttcgaaagctaggcatacatcctttt
cagaacagtggcttcaatcactggaaaatggcctatagtttgtgtaggtatcgccgtgtt
atcactgtgcaccagatctctccagaagagatgcacagaatctggaatgacatgtcaagc
aagaaacatctcagatgctag

DBGET integrated database retrieval system