KEGG   Heterocephalus glaber (naked mole rat): 101712358Help
Entry
101712358         CDS       T02812                                 

Gene name
Gys1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00500  Starch and sucrose metabolism
hgl01100  Metabolic pathways
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04910  Insulin signaling pathway
hgl04922  Glucagon signaling pathway
hgl04931  Insulin resistance
Module
hgl_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101712358 (Gys1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101712358 (Gys1)
   04152 AMPK signaling pathway
    101712358 (Gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101712358 (Gys1)
   04922 Glucagon signaling pathway
    101712358 (Gys1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    101712358 (Gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101712358 (Gys1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101712358 (Gys1)
Glycosyltransferases [BR:hgl01003]
 Polysaccharide
  Storage polysaccharide
   101712358 (Gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101712358
NCBI-ProteinID: XP_004867023
UniProt: G5BAG4
LinkDB All DBs
Position
Un
AA seq 735 aa AA seqDB search
MPLSRTLSVSSLPGLEEWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPAFKKTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANAVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPREGPLEDGERYDEDEEAAKDRRNIRAPEWPRRSSCTSSTGKRSNSVDTAPSSSLSTP
SEPLSPASSLGEERN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgagccgcacgttgtctgtgtcctcactgccaggcctggaagagtgggaggat
gagttcgacctggagaacacagtgctcttcgaagtggcctgggaggtggccaacaaggtg
gggggcatctacacggtgctgcagaccaaggcgaaggtgacaggggacgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctt
gagcccccgaccccggcctttaagaagacgctggactccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgattgaggggggcccgctggtggtgctcctggatgtaggg
gcctcagcctgggccctggaacgctggaaaggagagctctgggacacctgcaacatcggg
gtgccctggtacgaccgagaggccaatgatgctgttctctttggcttcctcaccacctgg
ttcctcggtgagttcctggcccagagtgaggagaagccacatgtggttgcccacttccat
gagtggttggcaggcgttgggctctgcctgtgccgtgcccggcggctgcctgtggcaacc
atcttcaccacccatgccacgctgctggggcgttacctgtgcgctggtgctgtagacttc
tacaacaacctggagaatttcaatgtagacaaggaagcaggggagagacaaatctatcac
cgctactgcatggagcgggcagcagcccactgtgctcatgtcttcaccaccgtgtcccag
ataactgccattgaggcgcagcacctactcaagaggaagccagatattgtgacccccaac
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaagcgcggatccaggaatttgtccggggccatttttatgggcacctggacttcaacttg
gacaagactttgtatttctttattgctggccgctacgagttctctaacaagggggcggac
gtcttcctggaagccttggcccggctcaactacctgctcagagtgaatggcagtgaacag
acggtggtcgccttcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctc
aagggccaggctgtgcgcaagcagctgtgggacacggccaacgcggtgaaggagaagttt
gggaggaagctgtatgaatccttactggtggggagtctcccagacatgaataagatgctg
gacaaagaggacttcactatgatgaagagggccatctttgccacacagcggcagtccttc
cctcctgtgtgcacccacaatatgctggacgactcctcagaccccatcctgaccaccatc
cgccggattggcctcttcaatagcagcgcggacagggttaaggtgatttttcacccagag
ttcctctcctctacaagccccctgctccctgtggactatgaggagtttgtgcgtggctgt
caccttggggtcttcccctcctactatgagccttggggctacacaccagccgagtgtacg
gtcatgggcatccccagtatctccaccaacctctccggctttggctgcttcatggaggag
cacatcgcagacccctcagcttacggtatctacattctggaccggcggttccgcagcctg
gacgattcctgctcacagctcacctccttcctctacagcttctgccagcagagccgcaga
cagcgcatcatccagcggaaccgcacagagcgtctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcacgccacatggccctggccaaggcctttccggatcat
ttcacctacgagccccacgaagcggatgcagcccagggctaccgctacccacggccggcc
tcagtgccgccgtcaccctcgttgtcacgacactcgagtccgcaccagagcgaggatgag
gaggaaccccgggaagggccacttgaagatggcgaacgatacgacgaggacgaggaagct
gccaaggatcggcgcaacatccgcgcccccgagtggccacgccgctcctcctgcacctct
tccacaggcaagcgcagcaactcggtggacactgcgccctccagctcgctgagcacgccc
agtgagcccctcagccccgccagctctctgggggaggagcgcaactaa

DBGET integrated database retrieval system