KEGG   Heterocephalus glaber (naked mole rat): 101712443
Entry
101712443         CDS       T02812                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101712443
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 101712443
NCBI-ProteinID: XP_004840601
LinkDB
Position
Un
AA seq 99 aa
MRCLISFALGLLALEAALALDLASVSSAEAMCPKVSSSEEMTCKEAQACITSQDCFGNAC
GRSCRTPNLQCPEHKKLPLGAGCPDTQGVQGPEPVCQRQ
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcgctgcctcatcagcttcgccctcggcctgctcgccttggaggcagccctggcactg
gacctggcctctgtctcctcagctgaggccatgtgccccaaggtcagctcctctgaggag
atgacctgcaaagaagcgcaagcctgcatcaccagccaggactgcttcggcaacgcctgc
ggccgctcctgcagaacccccaatctacaatgcccagaacacaagaaactgcccctgggt
gcaggctgccctgacacccaaggagtgcaagggccagagccagtgtgccaaagacaatga

DBGET integrated database retrieval system