KEGG   Heterocephalus glaber (naked mole rat): 101712621
Entry
101712621         CDS       T02812                                 

Gene name
Ccnd1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04218  Cellular senescence
hgl04310  Wnt signaling pathway
hgl04340  Hedgehog signaling pathway
hgl04371  Apelin signaling pathway
hgl04390  Hippo signaling pathway
hgl04510  Focal adhesion
hgl04530  Tight junction
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05216  Thyroid cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101712621 (Ccnd1)
   04340 Hedgehog signaling pathway
    101712621 (Ccnd1)
   04390 Hippo signaling pathway
    101712621 (Ccnd1)
   04371 Apelin signaling pathway
    101712621 (Ccnd1)
   04630 JAK-STAT signaling pathway
    101712621 (Ccnd1)
   04068 FoxO signaling pathway
    101712621 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    101712621 (Ccnd1)
   04152 AMPK signaling pathway
    101712621 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101712621 (Ccnd1)
   04115 p53 signaling pathway
    101712621 (Ccnd1)
   04218 Cellular senescence
    101712621 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101712621 (Ccnd1)
   04530 Tight junction
    101712621 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101712621 (Ccnd1)
   04921 Oxytocin signaling pathway
    101712621 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    101712621 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101712621 (Ccnd1)
   05206 MicroRNAs in cancer
    101712621 (Ccnd1)
   05205 Proteoglycans in cancer
    101712621 (Ccnd1)
   05203 Viral carcinogenesis
    101712621 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101712621 (Ccnd1)
   05212 Pancreatic cancer
    101712621 (Ccnd1)
   05225 Hepatocellular carcinoma
    101712621 (Ccnd1)
   05226 Gastric cancer
    101712621 (Ccnd1)
   05214 Glioma
    101712621 (Ccnd1)
   05216 Thyroid cancer
    101712621 (Ccnd1)
   05221 Acute myeloid leukemia
    101712621 (Ccnd1)
   05220 Chronic myeloid leukemia
    101712621 (Ccnd1)
   05218 Melanoma
    101712621 (Ccnd1)
   05219 Bladder cancer
    101712621 (Ccnd1)
   05215 Prostate cancer
    101712621 (Ccnd1)
   05213 Endometrial cancer
    101712621 (Ccnd1)
   05224 Breast cancer
    101712621 (Ccnd1)
   05222 Small cell lung cancer
    101712621 (Ccnd1)
   05223 Non-small cell lung cancer
    101712621 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101712621 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101712621 (Ccnd1)
   04934 Cushing syndrome
    101712621 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101712621 (Ccnd1)
   05162 Measles
    101712621 (Ccnd1)
   05160 Hepatitis C
    101712621 (Ccnd1)
   05163 Human cytomegalovirus infection
    101712621 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101712621 (Ccnd1)
   05169 Epstein-Barr virus infection
    101712621 (Ccnd1)
   05165 Human papillomavirus infection
    101712621 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101712621 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101712621
NCBI-ProteinID: XP_004852227
UniProt: G5BSR9
LinkDB
Position
Un
AA seq 295 aa
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSPNNFLTCYRLTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNLDPKATEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaggtggagaccatccgccgcgcgtacccggacacc
aacctcctcaatgaccgggtgttgcgagccatgctgaaggcggaggagacctgcgcgccc
tccgtgtcctacttcaagtgtgtgcagaaggaaatcctgccgtccatgcggaagatcgtg
gctacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgttggagcctctaaagaagagccgcctccag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccatccccctgacg
gccgagaagttgtgcatctacactgacaactccatccggcccgaagagctgctgcaaatg
gagctgctcctggtgaacaaactcaagtggaacctggctgccatgaccccccatgatttc
atcgaacacttcctgtccaaaatgccagaggctgaggagaacaaacagatcatccgcaaa
cacgcacagacttttgtcgccctgtgtgctacagacgtgaagttcatttccaacccaccc
tccatggtggcagctggaagcgtggtggccgcagtacaaggcctgcacctgggtagcccc
aacaacttcctgacctgctaccgcctgacgcacttcctctccagagtgatcaagtgtgac
ccggactgcctgcgtgcctgccaggagcagatcgaggccctgctggagtccagcctgcgc
caggcccagcagaatttggaccccaaggccacagaggaagaggaggaagaggaggaggag
gtggacctggcctgcacacccactgacgtgcgggatgtggacatctga

DBGET integrated database retrieval system