KEGG   Heterocephalus glaber (naked mole rat): 101713304Help
Entry
101713304         CDS       T02812                                 

Gene name
Sod1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04146  Peroxisome
hgl04213  Longevity regulating pathway - multiple species
hgl05014  Amyotrophic lateral sclerosis (ALS)
hgl05016  Huntington disease
hgl05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101713304 (Sod1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101713304 (Sod1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101713304 (Sod1)
   05016 Huntington disease
    101713304 (Sod1)
   05020 Prion diseases
    101713304 (Sod1)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101713304 (Sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101713304
NCBI-ProteinID: XP_012926741
UniProt: A0A0P6JIA7
LinkDB All DBs
Position
Un
AA seq 153 aa AA seqDB search
MATKAVCVLKGDGPVHGTIHFEQQGNGPVVVKGRIAGLNEGQHGFHVHEFGDNTKGCTSA
GPHFNPLSKKHGGPKDEERHVGDLGNVTAGTDGVAEVSIEDSLISLFGPNSIIGRTMVVH
EKEDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaaggccgtgtgcgtgctgaagggcgacggcccggtgcacggcaccatccac
ttcgagcagcagggaaacgggccagttgtggtaaagggacgcattgcaggattgaatgaa
ggccagcacggattccatgtccatgagtttggcgataacaccaaaggctgtaccagtgca
ggtcctcactttaatcctctgtccaaaaaacatggtgggccaaaggacgaagagaggcac
gttggagacctgggcaatgtgactgcaggcacagatggtgtggctgaagtatccattgag
gattctttgatctcacttttcggaccgaattccatcattggccgcacaatggtggtccat
gaaaaagaagatgacctgggcaaaggtgggaatgaagaaagtacaaagaccggaaatgct
ggaagtcgcctggcttgtggtgtgattgggatcgcccagtaa

DBGET integrated database retrieval system