KEGG   Heterocephalus glaber (naked mole rat): 101713410
Entry
101713410         CDS       T02812                                 

Gene name
Bcl2l1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01524  Platinum drug resistance
hgl04014  Ras signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04115  p53 signaling pathway
hgl04137  Mitophagy - animal
hgl04140  Autophagy - animal
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl04621  NOD-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl05012  Parkinson disease
hgl05014  Amyotrophic lateral sclerosis
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05145  Toxoplasmosis
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05168  Herpes simplex virus 1 infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101713410 (Bcl2l1)
   04630 JAK-STAT signaling pathway
    101713410 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    101713410 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    101713410 (Bcl2l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101713410 (Bcl2l1)
   04137 Mitophagy - animal
    101713410 (Bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    101713410 (Bcl2l1)
   04215 Apoptosis - multiple species
    101713410 (Bcl2l1)
   04115 p53 signaling pathway
    101713410 (Bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101713410 (Bcl2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101713410 (Bcl2l1)
   05202 Transcriptional misregulation in cancer
    101713410 (Bcl2l1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101713410 (Bcl2l1)
   05225 Hepatocellular carcinoma
    101713410 (Bcl2l1)
   05220 Chronic myeloid leukemia
    101713410 (Bcl2l1)
   05222 Small cell lung cancer
    101713410 (Bcl2l1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101713410 (Bcl2l1)
   05014 Amyotrophic lateral sclerosis
    101713410 (Bcl2l1)
   05022 Pathways of neurodegeneration - multiple diseases
    101713410 (Bcl2l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101713410 (Bcl2l1)
   05170 Human immunodeficiency virus 1 infection
    101713410 (Bcl2l1)
   05162 Measles
    101713410 (Bcl2l1)
   05168 Herpes simplex virus 1 infection
    101713410 (Bcl2l1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101713410 (Bcl2l1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101713410 (Bcl2l1)
   01524 Platinum drug resistance
    101713410 (Bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101713410 (Bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101713410 (Bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hgl02000]
    101713410 (Bcl2l1)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101713410 (Bcl2l1)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101713410 (Bcl2l1)
Transporters [BR:hgl02000]
 Other transporters
  Pores ion channels [TC:1]
   101713410 (Bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101713410
NCBI-ProteinID: XP_004840656
UniProt: G5BQH7
LinkDB
Position
Un
AA seq 233 aa
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEESRTEAPEGTESEMETPSAISGNPSWHLA
DSPTVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVRRIASWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGMVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaactgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagttcagtgatgtggaagagagcaggactgaagccccagaaggg
actgaatcagagatggagacccccagtgccatcagtggcaacccatcctggcacctggcg
gatagccccacggtgaacggggcaactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtgaagcaggctctgagggaagcaggtgacgagtttgaacttcgg
taccggcgggcattcagtgacctaacatctcagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcattgtgcgtggagagcgtagacaaggagatgcag
gtattggtgaggcggatcgcaagctggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggaggctgggacacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg
gctggcatggttctgctgggctcactcttcagtcggaaatga

KEGG   Heterocephalus glaber (naked mole rat): 101720105
Entry
101720105         CDS       T02812                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01524  Platinum drug resistance
hgl04014  Ras signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04115  p53 signaling pathway
hgl04137  Mitophagy - animal
hgl04140  Autophagy - animal
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl04621  NOD-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl05012  Parkinson disease
hgl05014  Amyotrophic lateral sclerosis
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05145  Toxoplasmosis
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05168  Herpes simplex virus 1 infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101720105
   04630 JAK-STAT signaling pathway
    101720105
   04064 NF-kappa B signaling pathway
    101720105
   04151 PI3K-Akt signaling pathway
    101720105
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101720105
   04137 Mitophagy - animal
    101720105
  09143 Cell growth and death
   04210 Apoptosis
    101720105
   04215 Apoptosis - multiple species
    101720105
   04115 p53 signaling pathway
    101720105
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101720105
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101720105
   05202 Transcriptional misregulation in cancer
    101720105
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101720105
   05225 Hepatocellular carcinoma
    101720105
   05220 Chronic myeloid leukemia
    101720105
   05222 Small cell lung cancer
    101720105
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101720105
   05014 Amyotrophic lateral sclerosis
    101720105
   05022 Pathways of neurodegeneration - multiple diseases
    101720105
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101720105
   05170 Human immunodeficiency virus 1 infection
    101720105
   05162 Measles
    101720105
   05168 Herpes simplex virus 1 infection
    101720105
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101720105
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101720105
   01524 Platinum drug resistance
    101720105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101720105
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101720105
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hgl02000]
    101720105
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101720105
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101720105
Transporters [BR:hgl02000]
 Other transporters
  Pores ion channels [TC:1]
   101720105
SSDB
Motif
Pfam: Bcl-2 BH4 SQHop_cyclase_C Bcl-2_3 DUF3094
Other DBs
NCBI-GeneID: 101720105
NCBI-ProteinID: XP_004854656
LinkDB
Position
Un
AA seq 229 aa
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEESRTEGPEGTESEMETPSAISGNPVDSPT
VNRATGHSSSLDAREVIPMAAVKQALREAVDEFELRYRRVFGDLTSQLHTTPGTTYRSFE
QVVNELFRDGVNWGRIVAFFSFGGALCLESVDKEMQVLVRRIASWMATYLNDHLEPWIQE
NGGWDTFVELYGNNAAAESRKGQERFNRWFLMGLTVAGIVLLGLLFSRK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgtctcagagcaactgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagttcagtgatgtggaagagagcaggactgaaggcccagaaggg
actgaatcagagatggagacccccagtgccatcagtggcaacccagtggatagccccacg
gtgaaccgggcaactggccacagcagcagtttggatgcccgggaggtgatccccatggca
gcagtaaagcaagctctgagggaagcggtcgacgagtttgaactgcgctaccggcgggta
ttcggtgacctaacatctcagctccacaccaccccagggacaacatatcggagctttgaa
caggtagtgaatgaactcttccgggatggggtaaactggggtcgcattgtggcctttttc
tccttcggcggggcattgtgcttggagagcgtagacaaggagatgcaggtattggtgagg
cggattgcaagctggatggccacttacctgaatgaccacctagagccttggatccaggag
aacggaggctgggacacttttgtggaactctatgggaacaatgcagcagccgagagccgg
aagggtcaggaacgcttcaaccgctggttcctgatgggccttactgtggctggcattgtt
ctgctgggcttactctttagtcggaaatga

DBGET integrated database retrieval system