KEGG   Heterocephalus glaber (naked mole rat): 101713575
Entry
101713575         CDS       T02812                                 

Gene name
Bax
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04071  Sphingolipid signaling pathway
hgl04115  p53 signaling pathway
hgl04141  Protein processing in endoplasmic reticulum
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04215  Apoptosis - multiple species
hgl04217  Necroptosis
hgl04722  Neurotrophin signaling pathway
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05012  Parkinson disease
hgl05014  Amyotrophic lateral sclerosis
hgl05016  Huntington disease
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05132  Salmonella infection
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05203  Viral carcinogenesis
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101713575 (Bax)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    101713575 (Bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101713575 (Bax)
   04215 Apoptosis - multiple species
    101713575 (Bax)
   04217 Necroptosis
    101713575 (Bax)
   04115 p53 signaling pathway
    101713575 (Bax)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101713575 (Bax)
  09149 Aging
   04211 Longevity regulating pathway
    101713575 (Bax)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101713575 (Bax)
   05202 Transcriptional misregulation in cancer
    101713575 (Bax)
   05203 Viral carcinogenesis
    101713575 (Bax)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101713575 (Bax)
   05212 Pancreatic cancer
    101713575 (Bax)
   05225 Hepatocellular carcinoma
    101713575 (Bax)
   05226 Gastric cancer
    101713575 (Bax)
   05214 Glioma
    101713575 (Bax)
   05216 Thyroid cancer
    101713575 (Bax)
   05220 Chronic myeloid leukemia
    101713575 (Bax)
   05217 Basal cell carcinoma
    101713575 (Bax)
   05218 Melanoma
    101713575 (Bax)
   05213 Endometrial cancer
    101713575 (Bax)
   05224 Breast cancer
    101713575 (Bax)
   05222 Small cell lung cancer
    101713575 (Bax)
   05223 Non-small cell lung cancer
    101713575 (Bax)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101713575 (Bax)
   05014 Amyotrophic lateral sclerosis
    101713575 (Bax)
   05016 Huntington disease
    101713575 (Bax)
   05020 Prion disease
    101713575 (Bax)
   05022 Pathways of neurodegeneration - multiple diseases
    101713575 (Bax)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101713575 (Bax)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101713575 (Bax)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101713575 (Bax)
   05152 Tuberculosis
    101713575 (Bax)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101713575 (Bax)
   05170 Human immunodeficiency virus 1 infection
    101713575 (Bax)
   05161 Hepatitis B
    101713575 (Bax)
   05160 Hepatitis C
    101713575 (Bax)
   05164 Influenza A
    101713575 (Bax)
   05162 Measles
    101713575 (Bax)
   05168 Herpes simplex virus 1 infection
    101713575 (Bax)
   05163 Human cytomegalovirus infection
    101713575 (Bax)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101713575 (Bax)
   05169 Epstein-Barr virus infection
    101713575 (Bax)
   05165 Human papillomavirus infection
    101713575 (Bax)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101713575 (Bax)
   01524 Platinum drug resistance
    101713575 (Bax)
   01522 Endocrine resistance
    101713575 (Bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hgl03029]
    101713575 (Bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hgl02000]
    101713575 (Bax)
Mitochondrial biogenesis [BR:hgl03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101713575 (Bax)
Transporters [BR:hgl02000]
 Other transporters
  Pores ion channels [TC:1]
   101713575 (Bax)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101713575
NCBI-ProteinID: XP_004867027
UniProt: G5BAG6
LinkDB
Position
Un
AA seq 192 aa
MDGSGEHPRGGGPTSSEHIMKTGALLLQGFIQDRAGHMGGDTLELAMEQVPQDPSTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKNLG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaccccagaggaggcgggcccaccagctctgagcacatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcacatgggcggg
gataccctggagctggccatggagcaggtgccccaggacccgtccaccaagaagctgagc
gagtgtctcaagcggattggggacgaactggacagcaacatggagctgcagaggatgatt
gcggccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
gctgatggcaacttcaactggggccgggttgtcgcccttttctattttgccagcaaactg
gtgctcaaggcgctgtgtaccaaggtgccggagctgatcaggaccatcatgggctggaca
ctggacttcctccgcgagcggctgctgggctggatccaggaccaggggggttgggatggc
ctcctctcctacttcggaaccccgacctggcagacggtgaccatcttcgtggctggcgtg
ctcactgcctcactcaccatctggaagaacttgggctga

DBGET integrated database retrieval system