KEGG   Heterocephalus glaber (naked mole rat): 101713887
Entry
101713887         CDS       T02812                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00230  Purine metabolism
hgl01100  Metabolic pathways
hgl01522  Endocrine resistance
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04114  Oocyte meiosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04270  Vascular smooth muscle contraction
hgl04371  Apelin signaling pathway
hgl04540  Gap junction
hgl04611  Platelet activation
hgl04713  Circadian entrainment
hgl04714  Thermogenesis
hgl04723  Retrograde endocannabinoid signaling
hgl04724  Glutamatergic synapse
hgl04725  Cholinergic synapse
hgl04727  GABAergic synapse
hgl04740  Olfactory transduction
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04911  Insulin secretion
hgl04912  GnRH signaling pathway
hgl04913  Ovarian steroidogenesis
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04916  Melanogenesis
hgl04918  Thyroid hormone synthesis
hgl04921  Oxytocin signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04925  Aldosterone synthesis and secretion
hgl04926  Relaxin signaling pathway
hgl04927  Cortisol synthesis and secretion
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04934  Cushing syndrome
hgl04935  Growth hormone synthesis, secretion and action
hgl04962  Vasopressin-regulated water reabsorption
hgl04970  Salivary secretion
hgl04971  Gastric acid secretion
hgl04972  Pancreatic secretion
hgl04976  Bile secretion
hgl05032  Morphine addiction
hgl05163  Human cytomegalovirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101713887 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101713887 (Adcy3)
   04371 Apelin signaling pathway
    101713887 (Adcy3)
   04020 Calcium signaling pathway
    101713887 (Adcy3)
   04072 Phospholipase D signaling pathway
    101713887 (Adcy3)
   04024 cAMP signaling pathway
    101713887 (Adcy3)
   04022 cGMP-PKG signaling pathway
    101713887 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101713887 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101713887 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101713887 (Adcy3)
   04062 Chemokine signaling pathway
    101713887 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    101713887 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    101713887 (Adcy3)
   04912 GnRH signaling pathway
    101713887 (Adcy3)
   04913 Ovarian steroidogenesis
    101713887 (Adcy3)
   04915 Estrogen signaling pathway
    101713887 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    101713887 (Adcy3)
   04921 Oxytocin signaling pathway
    101713887 (Adcy3)
   04926 Relaxin signaling pathway
    101713887 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    101713887 (Adcy3)
   04918 Thyroid hormone synthesis
    101713887 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    101713887 (Adcy3)
   04916 Melanogenesis
    101713887 (Adcy3)
   04925 Aldosterone synthesis and secretion
    101713887 (Adcy3)
   04927 Cortisol synthesis and secretion
    101713887 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101713887 (Adcy3)
   04270 Vascular smooth muscle contraction
    101713887 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    101713887 (Adcy3)
   04971 Gastric acid secretion
    101713887 (Adcy3)
   04972 Pancreatic secretion
    101713887 (Adcy3)
   04976 Bile secretion
    101713887 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101713887 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101713887 (Adcy3)
   04727 GABAergic synapse
    101713887 (Adcy3)
   04725 Cholinergic synapse
    101713887 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    101713887 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    101713887 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    101713887 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    101713887 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    101713887 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101713887 (Adcy3)
   04714 Thermogenesis
    101713887 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101713887 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    101713887 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101713887 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101713887 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101713887 (Adcy3)
   05163 Human cytomegalovirus infection
    101713887 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101713887 (Adcy3)
Enzymes [BR:hgl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101713887 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 101713887
NCBI-ProteinID: XP_004839155
LinkDB
Position
Un
AA seq 1189 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPERGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLVVAGIGLLLDVI
LFVLCKKGLLPDRVSRKVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVLISVASCVVHTLVLGVTVAQQQQEELQGMQLLREILANVFLYLCAIIVG
VMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAVSAR
ASAAWTPLLRSWSPLAFLCPLPLPCWGGTGSPGRALPFQKYHQLRIKILGDCYYCICGLP
DYREDHAVCSILMGLAMVEAISYVREKTRTGVDMRVGVHTGTVLGGVLGQKRWQYDVWST
DVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGDGGSRCDYLEEKGIETYLVIASKP
EVKNTATQKGRHGLALPNGAPVSSKPSSPVLIETKEPNGSAHTSGSTSEEPEEQEAQADN
PSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLSMRFMD
PEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTFVVGEILLLILTIC
SLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYAGPYNG
TAELELEGSCLENPKYYSYIAVLSLIATIMLVQVSHMVKLTLMLLVTGAAATISLYTWCP
VFDKYDHKRFQEHAFPMVASEKMQVLSTPGLNGTDSRLPLVPSKYSMTVMILIMMLSFYY
FSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELY
SQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIK
TIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADFALAMKDTLTNINNQSF
NNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQIILRE
YGFRFVRRGPIFVKGKGELLTFFLKGRDRPPAFPNGSSVTLPHQVVDNS
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgagtactccgccgagtactcagcggagtat
tccgtcagcctgccctctgaccctgaacgcggggtgggtcggacccatgaaatctccgtc
cggaactcggggtcttgcctgtgtctgcctcgcttcatgcgcctgaccttcgtgcctgag
tccttggagaacctctaccagacctacttcaaaaggcagcgtcacgagaccctgctggtt
ctggtggtcttcgcggccctgtttgactgctacgtggtggtcatgtgcgctgtggtcttc
tccagcgacaagctggcccccctcgtggtggcggggatcggactgctgttggacgtcatc
ctctttgtactctgcaaaaagggtctgctccctgaccgggtcagccggaaggtggttccc
tacctgctgtggctgctgatcacagcccagatcttctcctatctgggcctgaacttcgcc
cgggcccacgcggccagtgacactgtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcctctcagcctcagccccatcgtgctcatctctgtggcctcctgtgttgtg
cacacactcgtcctgggggtcacggtggcccagcagcagcaggaggagctgcaggggatg
cagctgctgagagagatcctggccaatgtcttcctctacctgtgcgccatcatcgtgggc
gtcatgtcctactacatggccgaccggaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacttggaggagcagagccagcagcaggagaacctcatgctc
tccatcctgcccaagcacgtggctgacgagatgttgaaggacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagcatc
ctctttgcggacatcgtgggcttcacccagctgtcatctgcctgcagcgctcaggagctg
gtgaagctgctcaacgagctctttgcccgctttgacaagctggccgctgtaagtgcccgg
gcgtcggccgcctggacgcccctgcttcgcagttggtccccacttgccttcctttgccct
ttgccactcccatgctggggagggactgggagcccaggccgtgccctgccctttcagaaa
taccaccagctccggatcaagatcctgggcgactgctactactgcatctgcggcctgccc
gactaccgcgaggaccacgccgtttgctccatcctcatggggctcgccatggtggaggcc
atctcgtacgttcgtgagaagaccaggaccggagtggacatgcgtgtgggcgtgcacacg
ggcacggtgctgggtggcgtcctgggccagaagcgctggcagtatgacgtgtggtccact
gacgtcactgtggccaacaagatggaggctggcggcatcccagggcgcgtgcacatctcc
cagagcaccttggactgtctgaagggcgagttcgacgtggagccgggcgatgggggcagc
cgctgcgattacctggaagagaagggcatcgagacctacctggtcatcgcctccaagccg
gaggtgaagaacacagccacccagaagggccgccacggcttggccctcccgaatggagcc
ccagtgtcctcgaagcccagctcccctgtcctcattgagaccaaggagcctaatggcagt
gcccacaccagcggctccacatcggaggagcctgaggagcaggaggcccaggccgacaac
ccctcgttccccaacccccgccgcaggctgcgcctccaggacctggctgaccgagtggtg
gatgcctccgaggatgagcatgagctcaaccagctgctcaatgaggccctgctggagcga
gagtctgcccaggtggtaaagaagagaaacacattcctcctctccatgcgcttcatggac
ccggagatggagacccgctactcggtggaaaaggagaagcagagtggggccgccttcagc
tgctcctgtgtggtcctgctctgcaccgccctggttgagatcctcatcgacccgtggctg
atgacaaactatgtgaccttcgtggttggggagatcctgctgctgatcctgaccatctgc
tcactggccgccatctttccccgggcctttcctaagaagcttgtggccttctcaacttgg
attgaccggacccgctgggccaggaatacctgggccatgctggccatcttcattctggtt
atggcaaacgtcgtggacatgcttagctgtctccagtactacgcaggaccctacaacggg
acggcagagctagagctagagggcagctgcctggagaaccccaagtattacagctacatc
gccgtgctgtccctcattgccaccatcatgctggtgcaggtcagccacatggtgaagctt
acactcatgctgctggtcacgggcgcagcggccaccatcagcctctacacctggtgccct
gtctttgataaatacgaccacaaacgcttccaggagcatgcctttcccatggtggcctca
gagaagatgcaggtgctttccacccctgggctcaatggcacagacagcaggctgcccctg
gtaccttcgaagtactcgatgacagtgatgatactcatcatgatgctgagcttttactac
ttctcccgacacgtggaaaaactggcacgaacactgtttttgtggaagattgaggtccat
gaccagaaggaacgtgtgtatgagatgcgacgctggaatgaggccctggtcaccaacatg
ttgcctgagcatgtcgcgaggcatttccttgggtccaagaagagagatgaggagctgtat
agccagtcctatgatgagattggagtcatgtttgcctctctgcccaactttgctgacttt
tatactgaggagagcatcaataatggtggcatcgagtgtctgcggttcctcaatgagatc
atctctgatttcgactctctcctggacaaccccaaattccgggtcatcaccaagatcaaa
accattggcagcacctatatggcagcttcaggagtcaccccagatgtgaacaccaatggc
ttcaccagctcaaacaaggaggagaagtcagacaaggagcgttggcaacacctggctgac
ctggcggactttgcccttgctatgaaggatacgcttacaaacatcaacaaccagtccttc
aacaactttatgctgcgcataggcatgaacaaaggaggggttctggctggggtcattgga
gcccggaaaccacactacgacatctggggcaatacagtcaacgtggccagcaggatggag
tccacaggggtgatgggcaacattcaggtggtggaggaaacacaaatcatcctccgagag
tacggcttccgctttgtgaggcgaggtcccatctttgtgaaggggaagggagagctgctg
actttcttcttgaagggacgagacaggccacctgccttccccaatggctcctccgttaca
ctgccccaccaggtggtggacaactcctga

DBGET integrated database retrieval system