KEGG   Heterocephalus glaber (naked mole rat): 101714164Help
Entry
101714164         CDS       T02812                                 

Gene name
Sod2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04068  FoxO signaling pathway
hgl04146  Peroxisome
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101714164 (Sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101714164 (Sod2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    101714164 (Sod2)
   04213 Longevity regulating pathway - multiple species
    101714164 (Sod2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    101714164 (Sod2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101714164 (Sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 101714164
NCBI-ProteinID: XP_004869082
UniProt: G5BC70
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLPYAACSASRRLAPALGLLGVRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNATEEKYQEALVKGDVTTQVALQPALRFNGGGHINHTIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttaccctacgcggcgtgcagcgctagccggaggctggccccggctttggggctcctg
ggcgtacggcagaagcacagcctccccgacttgccctacgactatggggccctggagccg
cacattaacgcccagatcatgcagctgcaccactccaagcaccacgcagcctatgtgaac
aatttgaacgccaccgaggagaagtaccaggaggcgctggtcaagggagatgttacgact
caggtcgctcttcagcctgcactgaggttcaatggtggaggtcacatcaatcacaccatt
ttctggacgaacctgagccctaatggtggtggagaacctaaaggggaattactggaagcc
atcaagcgtgactttggttcctttgacaagtttaaggagaagctgacagctgtgtccgtt
ggcgtccaaggctctgggtggggctggcttggtttcaataaagagcaggggcgcttacag
attgctgcctgttctaatcaggatccgctgcaaggaacaacaggtcttattccactgctg
gggattgacgtatgggagcatgcttattaccttcagtataaaaatgttcgacctgattat
ctaaaagctatttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgt
aaaaagtaa

DBGET integrated database retrieval system