KEGG   Heterocephalus glaber (naked mole rat): 101715048
Entry
101715048         CDS       T02812                                 

Gene name
Rad51
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03440  Homologous recombination
hgl03460  Fanconi anemia pathway
hgl05200  Pathways in cancer
hgl05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    101715048 (Rad51)
   03460 Fanconi anemia pathway
    101715048 (Rad51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101715048 (Rad51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101715048 (Rad51)
Membrane trafficking [BR:hgl04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    101715048 (Rad51)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    101715048 (Rad51)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     101715048 (Rad51)
    RecA family proteins
     101715048 (Rad51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     101715048 (Rad51)
SSDB
Motif
Pfam: Rad51 AAA_25 HHH_5 RecA ATPase HHH HhH-GPD ssDNA_TraI_N
Other DBs
NCBI-GeneID: 101715048
NCBI-ProteinID: XP_004861626
UniProt: A0A0N8EUC2
LinkDB
Position
Un
AA seq 339 aa
MAMQMQLEASADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
TNIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggccatgcagatgcagcttgaagcaagtgcagacacttcagtggaagaagaaagcttt
ggcccacagcctatttcacggttggagcagtgtggcataaatgccaatgatgtgaagaaa
ttagaagaagctggattccatactgtggaggctgttgcctatgcaccaaagaaggagtta
acaaatataaaaggaattagtgaagccaaagctgataaaattctggctgaggcagctaaa
ttagttccaatgggtttcaccactgcaactgaattccaccaaaggaggtcagagatcata
cagattactactggctccaaagagcttgacaaactacttcaaggtggaattgagactgga
tctatcacagagatgtttggagaattccgaactgggaagactcagatctgtcacactctg
gctgtcacgtgccagcttcccattgaccgaggtggaggtgaagggaaggccatgtacatc
gatactgagggtacctttaggccggaacggctcctagcagtggctgagaggtatggtctc
tctggcagtgatgttttggataatgttgcatatgctcgagggttcaacacagaccaccag
acgcagctcctttatcaggcatcagccatgatggttgagtccaggtatgcactgcttatt
gtagatagtgccaccgccctctacagaacagactactccggccgaggagagctctcagcc
aggcagatgcacttggccaggtttctgcggatgcttctgcgccttgctgatgagtttggt
gtagctgtggtaatcaccaaccaggtggtagctcaagtggatggagcagctatgttctct
gcagatcctaaaaaacctattggaggaaacatcatcgctcatgcatcaacaaccagactg
tacctgaggaaaggaagaggggaaaccagaatctgcaagatctatgactctccctgtctt
cctgaagctgaagctatgtttgccatcaatgcagatggagtgggagatgccaaagattga

DBGET integrated database retrieval system