KEGG   Heterocephalus glaber (naked mole rat): 101715102Help
Entry
101715102         CDS       T02812                                 

Gene name
Hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04110  Cell cycle
hgl04213  Longevity regulating pathway - multiple species
hgl04330  Notch signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl05016  Huntington disease
hgl05034  Alcoholism
hgl05165  Human papillomavirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05203  Viral carcinogenesis
hgl05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101715102 (Hdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101715102 (Hdac1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101715102 (Hdac1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101715102 (Hdac1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    101715102 (Hdac1)
   05202 Transcriptional misregulation in cancers
    101715102 (Hdac1)
   05203 Viral carcinogenesis
    101715102 (Hdac1)
   05220 Chronic myeloid leukemia
    101715102 (Hdac1)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    101715102 (Hdac1)
  09164 Substance dependence
   05034 Alcoholism
    101715102 (Hdac1)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    101715102 (Hdac1)
   05165 Human papillomavirus infection
    101715102 (Hdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101715102 (Hdac1)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101715102 (Hdac1)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101715102 (Hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     101715102 (Hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101715102 (Hdac1)
  Chromatin remodeling factors
   NuRD complex
    101715102 (Hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101715102
NCBI-ProteinID: XP_004850908
UniProt: A0A0P6JG70
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
MA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaggaggaaagtctgttactactacgatggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctgctgaactatggtctctaccgaaagatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttgcgctccatccgt
ccagataacatgtctgagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtatttgatggcctgtttgagttctgtcagttgtctgctggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggccgggggcctgcac
catgcaaagaagtccgaggcatccggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagagtgctgtatattgacattgatattcaccatggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tattatgctgttaactacccactccgagatggaattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcagtggtcttacag
tgtggttcagactccctctctggagatcgcctgggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggaatttgtcaaaagcttcaacctacctatgctgatgctgggagga
ggtggttataccattcgtaatgttgctcggtgctggacatacgaaacagctgtggctcta
gacacagagatccctaatgaacttccatacaatgactactttgaatactttggaccagat
ttcaagcttcacatcagtccttccaatatgactaaccagaacactaatgaatacctggag
aagatcaaacagcggctctttgagaatctgagaatgctgccccacgcacctggggtccaa
atgcaggcaattcctgaggatgccatccccgaggagagtggcgatgaggacgaagaagat
cctgacaagcgcatctcaatctgttcctctgacaaacgaattgcctgtgaggaagagttc
tctgactcagatgaggagggagaagggggccgcaagaactcttccaacttcaagaaagcc
aagagagtcaaaacagaagatgagaaagaaaaagacccagaagagaaaaaagaggtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaggaggtcaag
atggcctaa

DBGET integrated database retrieval system