KEGG   Heterocephalus glaber (naked mole rat): 101715175Help
Entry
101715175         CDS       T02812                                 

Gene name
Tmprss2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl05164  Influenza A
hgl05202  Transcriptional misregulation in cancer
hgl05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    101715175 (Tmprss2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    101715175 (Tmprss2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    101715175 (Tmprss2)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101715175 (Tmprss2)
Peptidases [BR:hgl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101715175 (Tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101715175
NCBI-ProteinID: XP_004842514
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MALNSGSPPGIGPYYENHGYQPENLYGSQPPVAPSVYAVYPARYYPAAVPQYTPRVPTHA
STPAVHRQPKAPSGTCSSRTKRLLCLVLVLGAILVGVALAAVLLWKFLENRCAVSGVECG
SSGICISPSLWCDGVPHCPSGEDENGCVRLYGPNFILQIYSPQRKSWYPVCQDSWSDSYG
RVACADLGYKNSFYSSRRIEDDSGATSFMKLNASAASTDLYKKLYLSDACFSHTVVSLRC
IECGVRSPGPQGRIVGGSAAAPGEWPWQVSLHVQGVHICGGSIISPQWIVTAAHCIEQPL
NSPRYWMAFAGTLRQSGMFYGDAHRVEKVIAHPNYDSSTKNNDVALFKLQTPLTFNDRVK
PVCLPNPGMQLDPKQQCWISGWGATYEKGKTSDLLNAASVPLIERSTCNHKYFYNNLITP
AMVCAGFPQGTVDSCQGDSGGPLVTFKNGVWWLIGDTSWGSGCAKAYRPGVYGNVTVFAD
WIYRQMRANS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcagggtctccgccgggcattggaccttactatgaaaaccacgggtac
caaccggagaacctctacggctcgcagccgcccgtggcacccagcgtctacgcagtgtac
ccggctcggtactacccggcggccgtgccccagtacaccccgagggtccccacgcacgcc
tccacacccgcggtccacaggcagcccaaggccccctcgggcacttgctcctcaaggacc
aagcggctgttgtgcctggtcttggtgctgggggccatcctggtgggcgttgcgctggct
gccgtcctgctgtggaagttcctggagaaccggtgtgcggtgtcgggggtggagtgcggc
agctccgggatctgcatcagcccctcgctctggtgtgacggtgtcccccactgccccagc
ggggaggacgagaatggctgcgttcgcctctacggacccaacttcatcctccagatctac
tcaccgcagaggaagtcctggtaccctgtgtgccaggacagctggagcgacagctacggg
cgggtggcctgcgccgacctgggctacaagaacagcttttattctagcagaagaatagag
gatgacagcggggcgaccagttttatgaagctcaacgcaagtgcggccagcactgatctc
tataagaaactgtacctcagtgatgcctgcttttcacacaccgtggtctccctgcgctgc
atagagtgtggtgtccgctcaccaggcccccagggcaggattgtgggcggctcagctgcg
gcaccgggagagtggccctggcaggtcagcctgcacgtccagggcgtccacatctgcgga
gggtccatcatctcaccccagtggattgtgacagccgcccactgcatagaacagcctctc
aacagcccgcggtactggatggcgttcgcggggacgctcaggcagtccggtatgttctac
ggagacgcgcaccgcgtggaaaaagtcatcgcgcaccccaattacgactccagcaccaag
aacaacgacgtcgccctctttaagttgcagacgccgctgactttcaacgacagggtgaag
cccgtgtgtctccccaaccccggcatgcagctggaccccaagcagcagtgctggatctcc
gggtggggggccacctatgagaaagggaagacctcggacttgctgaacgccgcctctgtg
cccctcatcgagcgctccacgtgcaaccacaagtacttctacaacaacctgatcaccccg
gccatggtctgcgcaggcttcccgcagggcaccgtggactcctgccagggtgacagtgga
gggccactggtcactttcaagaacggcgtctggtggctgatcggggacacgagctggggt
tcaggctgtgccaaggcgtacaggcccggggtgtacgggaacgtgacagtgttcgcagac
tggatctaccggcagatgcgggcgaacagctaa

DBGET integrated database retrieval system