KEGG   Heterocephalus glaber (naked mole rat): 101715346Help
Entry
101715346         CDS       T02812                                 

Gene name
F13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101715346 (F13a1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101715346 (F13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101715346
NCBI-ProteinID: XP_004847799
UniProt: A0A0P6K742
LinkDB All DBs
Position
Un
AA seq 732 aa AA seqDB search
MSDTARTTFGGRRAMPPNNSNAAEDELPTEELLGLVPRGVNLEDYLTVTDVHLFKEKWDS
NKIDHHTDKYDNSKLIVRRGQSFYIQIDFNRPYDPKKDFFRVEYVIGRYPQENKGTYIPV
PIVSKLQSGKWGAEVIMNEDRSVRLSVQPSPECIVGKFRMYVAVWTPYGILRTRRNPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAQMDLSGRGNPIKVSRVGSAMINAKDDQGVIVGSWDNVYAYGVPPSAWTGSVDIL
LEYRSSENPVQYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGN
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHMVESVDATHIGKLIVTKQIGGDGIQDITD
TYKFQEGQEEERLALETALMYGARKDMKTEGVVKSRSNVNMDFQVENAVLGKDFKVTITF
QNNSPNRYNVTAYLSGNITFYTGVSKTEFKNETFDVVLEPFSFKQKEVLVRAGEYMGQLL
EQAFLHFFVTARINESKDVLAKQKSTVLIIPKVIIKVRGAAMVGSDMVVTVEFTNPLKET
LQNVWIYLDGPGLLKPKRKMFREIHPNSTVQWEEVCRPWVSGPRKLIASMTSDSLRHVYG
ELDLEIQRRPSA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacactgccaggaccacctttgggggcaggagagcaatgccccccaacaactcc
aatgcagcagaagatgaactccccactgaggagctgctggggctggtgccgcggggcgtc
aacctggaagactaccttactgtcacagatgttcatctattcaaagagaaatgggactcc
aacaagatcgatcaccacactgacaaatatgacaacagcaagttgattgtgcggagagga
cagtctttctacatccagattgacttcaatcgtccctatgacccaaagaaggacttcttc
agggtggaatatgtcattggtcgctaccctcaggagaacaaggggacatacattccagta
cccattgtctccaagctgcagagtgggaagtggggggccgaagttatcatgaatgaggac
aggtctgtccggctgtccgtccagccttcccccgaatgcattgtggggaaattccgaatg
tacgtggctgtctggaccccctacggcatactccgcacacgcaggaaccccgagacagac
acatacatcctcttcaatccttggtgtgaagaggatgctgtgtatctggacgatgagaaa
gaaagagaagagtatgtcctgaacgatatcggggtgattttttatggagactttaatgac
atcaagagtagaagctggagctatggtcagtttgaagatggcattctcgatgcttgctta
tatgtgatggacaaagcacaaatggatctttctggtagaggaaatcccatcaaagtcagc
cgtgttgggtctgcaatgattaatgccaaagatgaccaaggtgtcatcgtgggatcctgg
gacaatgtctatgcctatggcgtccccccatcagcctggactggaagcgttgacatccta
ttggaatacaggagctctgagaatccagtccagtatggccagtgctgggtttttgctggt
gtctttaacacatttctgcgatgccttggaattccagcaagagtcattaccaattacttc
tcagcccatgataatgatgccaatttgcaaatggatatcttcctggaagaagatgggaat
gtgagttccaaactcaccaaggactcagtgtggaactaccactgctggaatgaagcttgg
atgacaaggccggatcttcctgttggatttggaggatggcaagctgtggacagtaccccc
caggaaaatagcgatggcatgtaccggtgtggccctgcctctgtccaagctgtcaagcac
ggccatgtgtgtttccagtttgacgcaccctttgtctttgcagaggtcaacagtgatctt
atttacattacagctaagaaggatggcacacatatggtagaaagtgtggatgccacccac
attgggaaattgattgtgaccaaacaaattggaggagatggcatacaggatattactgat
acttacaagttccaagaaggtcaggaagaagagagactggccctagaaactgccctcatg
tacggagcaagaaaggacatgaaaacagaaggtgtggtcaaatcaaggtcaaatgtgaac
atggattttcaagtggaaaatgctgttctggggaaggacttcaaggtcaccatcactttc
cagaacaacagtcccaaccgttacaacgtcacagcctatctctcgggcaacatcaccttc
tacaccggggtctccaagacagaattcaagaacgagacatttgatgtggtgctggagcct
ttttctttcaagcaaaaggaggtgctggtcagagcaggtgagtacatggggcagctgttg
gagcaggccttcctgcacttcttcgtcacagctcgcatcaatgagtccaaggatgtcctg
gctaagcagaagtccaccgtcctgatcatccccaaggtcatcatcaaggtccgaggagcc
gcaatggttggttctgacatggttgtcactgtagaatttaccaatcctttaaaagaaact
ctacaaaacgtctggatatacctagatggtcctggtttattaaaacccaaaaggaaaatg
ttccgtgaaattcatcccaactccaccgtgcaatgggaagaagtgtgtcggccttgggtc
tctggccctcggaagttgatagccagcatgaccagtgattccctgagacatgtgtatggt
gagctggacttggagattcaaagacgaccttctgcataa

DBGET integrated database retrieval system