KEGG   Heterocephalus glaber (naked mole rat): 101715591
Entry
101715591         CDS       T02812                                 

Gene name
Ddb2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03420  Nucleotide excision repair
hgl04115  p53 signaling pathway
hgl04120  Ubiquitin mediated proteolysis
hgl05161  Hepatitis B
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101715591 (Ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    101715591 (Ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101715591 (Ddb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101715591 (Ddb2)
   05202 Transcriptional misregulation in cancer
    101715591 (Ddb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101715591 (Ddb2)
   05212 Pancreatic cancer
    101715591 (Ddb2)
   05225 Hepatocellular carcinoma
    101715591 (Ddb2)
   05226 Gastric cancer
    101715591 (Ddb2)
   05214 Glioma
    101715591 (Ddb2)
   05216 Thyroid cancer
    101715591 (Ddb2)
   05220 Chronic myeloid leukemia
    101715591 (Ddb2)
   05217 Basal cell carcinoma
    101715591 (Ddb2)
   05218 Melanoma
    101715591 (Ddb2)
   05213 Endometrial cancer
    101715591 (Ddb2)
   05224 Breast cancer
    101715591 (Ddb2)
   05222 Small cell lung cancer
    101715591 (Ddb2)
   05223 Non-small cell lung cancer
    101715591 (Ddb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101715591 (Ddb2)
   05169 Epstein-Barr virus infection
    101715591 (Ddb2)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     101715591 (Ddb2)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      101715591 (Ddb2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 101715591
NCBI-ProteinID: XP_004851942
LinkDB
Position
Un
AA seq 425 aa
MIPRKRPETQKTPKVVVRPGSRRSPREREPEPAAKKPRTKGPGSSRRYDSGCLWAGLASL
QVPTVGSNIIRALHQHKLGKAAWPSIQQSLQQCFVHSLASYRIAQKASPFDRRATALAWH
PAHPSTLAVASKGGDIMLWNFGIKDKPTFIKGIGAGGSIMGLKFNLLNTDQFYAASMEGT
TRLQDFQGNTVRVFARTDCCNIWFCSLDVSAKSRVLVTGDNMGHVILLNTDGKELWNLRM
HKKKATHVALNPCCEWLLATASVDQTVKLWDLRQVKGKDSFLHLLPHSHPVNAACFSPDG
ARLLTTDQQNEIRVYSASQWDLPVSLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPN
FKSCVPYESRTVDMFDGNSGKLLCQLCDPESSGIISLNEFNPMGDTLASAMGYHVLIWSQ
EEVGP
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgattcccaggaagcgcccagaaacccagaagacccccaaagtggtggtgcgccccggg
agcagaaggagtccccgggagcgggagccggagcccgcggccaagaagccccgcacgaag
ggccccggttctagcaggagatatgactcaggctgcctttgggcggggctggccagcctg
caggtcccgacagtgggcagcaacatcatcagggccctgcaccagcataaactgggcaag
gctgcttggccgtcgatacagcagagtctgcagcagtgcttcgtgcactccctggcttct
taccggatagcccagaaggcctccccctttgacaggagggccacagccttggcctggcac
ccagcgcaccccagcaccctggctgtggcttccaaggggggtgatatcatgctctggaac
tttggcatcaaggacaaacccacattcatcaaagggatcggagctgggggcagcatcatg
ggcctgaagttcaaccttctcaacactgaccagttctacgccgcctccatggagggaaca
acaaggctgcaggactttcaaggcaacactgtccgagtttttgccagaactgattgctgc
aacatctggttctgcagcttggatgtgtctgccaagagccgagtgctggtcacaggagac
aacatgggccacgtgatcctgctgaacacagacggcaaggagctttggaatctcagaatg
cacaaaaagaaagcgacccatgtggccctgaacccctgctgtgagtggttactggccaca
gcctccgtagatcaaacagtgaagctctgggacctgcgccaggttaaagggaaggacagc
ttcctccacttgctgccacacagtcaccctgtcaacgcagcttgctttagccctgacgga
gcccggctgctgaccacggaccagcagaacgagatccgggtttactccgcttcgcagtgg
gacctccccgtgagcctgatcccgcacccacaccgccacttccagcacctcacccccatc
aaggcaacctggcatcctcggtacaacctcatcgttgtgggccggtacccagatcctaat
ttcaaaagttgtgttccctacgagtcaaggacagttgacatgtttgatggaaactctggg
aagttgctgtgtcagctctgtgacccagaatcttctggtatcatttcgctcaacgagttc
aaccccatgggggacacgttggcctcagccatgggttaccatgttctcatctggagccag
gaggaagttgggccttag

DBGET integrated database retrieval system