KEGG   Heterocephalus glaber (naked mole rat): 101715793
Entry
101715793         CDS       T02812                                 

Gene name
Atf6b
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04022  cGMP-PKG signaling pathway
hgl04141  Protein processing in endoplasmic reticulum
hgl04151  PI3K-Akt signaling pathway
hgl04211  Longevity regulating pathway
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04668  TNF signaling pathway
hgl04728  Dopaminergic synapse
hgl04911  Insulin secretion
hgl04915  Estrogen signaling pathway
hgl04918  Thyroid hormone synthesis
hgl04925  Aldosterone synthesis and secretion
hgl04926  Relaxin signaling pathway
hgl04927  Cortisol synthesis and secretion
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04934  Cushing syndrome
hgl04935  Growth hormone synthesis, secretion and action
hgl05020  Prion disease
hgl05030  Cocaine addiction
hgl05031  Amphetamine addiction
hgl05034  Alcoholism
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101715793 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101715793 (Atf6b)
   04022 cGMP-PKG signaling pathway
    101715793 (Atf6b)
   04151 PI3K-Akt signaling pathway
    101715793 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101715793 (Atf6b)
   04915 Estrogen signaling pathway
    101715793 (Atf6b)
   04926 Relaxin signaling pathway
    101715793 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    101715793 (Atf6b)
   04918 Thyroid hormone synthesis
    101715793 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    101715793 (Atf6b)
   04925 Aldosterone synthesis and secretion
    101715793 (Atf6b)
   04927 Cortisol synthesis and secretion
    101715793 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101715793 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    101715793 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    101715793 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101715793 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    101715793 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    101715793 (Atf6b)
   05031 Amphetamine addiction
    101715793 (Atf6b)
   05034 Alcoholism
    101715793 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101715793 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101715793 (Atf6b)
   05161 Hepatitis B
    101715793 (Atf6b)
   05163 Human cytomegalovirus infection
    101715793 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101715793 (Atf6b)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101715793 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 101715793
NCBI-ProteinID: XP_004846961
LinkDB
Position
Un
AA seq 707 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGVRNSTLYAGLDEVAEEPPQLFRCLEQDVPFDS
SSVDVGMDASPPEPPWDSLPIFPDLQVKSEPSSPSSSSSLISESSHLSAEPSSQAPGEGE
VLHVKSESLAPPLCLLGDDPTSPFEIVQITVGPSAGDPSDVQAKVEPASPSSSVNSEASL
LSAASPSQACAGEEVLEVKAESPSPAGCLLWDPSAPTLGAVQISMGPCPESCSAKAPPAR
KPPLQPKPMVLTTVQMPPRAVPPSTAVLLQPLVQPPAVSPVVLIQGAIRVQPEGPAPAGP
RPERKSIVPAPMPGNPCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFSFGPVSIGEPP
LAPGSRVGGQEPRPRPQRHLLEFSELQPAQGTEPLRGSPQGPKGRQPSPAAQPSFRNLTA
FPGAARELLLRDLDHVFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKSPLRAPERQE
RQRSQPRKKPLPVKAVPAQPPGPPERDPVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVS
FRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIH
IKTSTVPPSLRKQPSPAPGNATGGPLPASAASQAHRSSREPLYLSHP
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagtgagatcgcggatccgacgcgtttcttcaccgacaac
ctactgagcccggaggactggggtgtgcggaacagcaccttgtatgctggcctggatgaa
gtggccgaggagcctccgcagctcttccgctgcttggaacaagatgtcccgtttgacagc
agctccgtggatgtgggaatggatgccagcccccccgagcccccttgggactctctgcct
atcttcccagatcttcaggtgaagtctgagccatcctcccccagctcttcttcctccctc
atctctgaatcttcacatctctccgcagagccctccagccaggcccctggagaaggggag
gtgctgcacgtgaagtcagagtccttggcacccccgctttgcctcctgggagatgaccca
acatccccatttgaaatcgtccagatcactgtggggccctctgctggtgatccctcagat
gtccaggccaaggtggagcctgcctctccatcctcctccgtcaactcggaggcatccctg
ctctcagcggcctcccccagccaggcgtgtgcaggtgaggaggtgctggaagtgaaggca
gagtctccatcccctgcagggtgcctactctgggatccctcggcccccacactcggagca
gtccagatcagcatgggtccgtgccctgaaagttgctcagccaaagccccgcctgcccgg
aagccaccactgcagcccaaacccatggtgctcaccaccgtccagatgccacccagagcc
gtgcctcccagcactgcagttctgctgcagccgcttgtccagccgcctgcagtgtcccca
gtcgtcctcatccaaggtgctatccgagtccagcccgaagggccagcccccgctgggcca
cggcctgagaggaagagcatcgtcccggcccctatgcctgggaatccctgcccgcctgag
gtggacgcaaagctgctgaagcggcagcagcgcatgatcaagaaccgggagtcggcctgc
cagtcccggaggaagaagaaggagtacctgcaggggctggaggcgcggctacaggccgtg
ctggcagacaaccagcagctgcgccgggagaatgctgccctccggcggcgcctggaggcc
ctgctggccgagaacagcgagctcaagttggggtctggaaaccggaaagtggtctgcatc
atggtcttccttctcttcattgccttcagctttggccctgtcagcatcggtgagcctcct
ctggctcccggctcccgggtgggcgggcaggagccccggccccggccccagaggcacttg
ctggagttctcagagctgcagccggctcagggcacagagcccctccgggggtccccccag
ggccccaaggggcggcagcccagccctgcagcccagcccagcttcaggaacctgacagcc
ttccccggggctgcccgggagctgctgctgagggacctggaccatgtcttcctgtcctcc
gactgccggcacttcaaccgaaccgagtccctgaggcttgccgatgagctgagcggttgg
gtgcagcgccaccagagaggcaggcggaagagtcccctgagggccccggagagacaggag
agacagaggtctcagccacgcaagaagccgcttccagtgaaggccgtccccgcccagccc
cccgggcccccggaaagggaccccgtgggccagctgcagctctatcgccatccagaccgc
tcgcagccagagttcctggatgcgattgaccgtcgggaggacacgttttatgttgtctcc
ttccgaagggaccacttgctgcttccggccatcagccacaacaagacctcccgccccaag
atgtccctggtgatgcccgccatggcccccaatgagaccctgtcaggccggggggccccg
ggggactatgaggagatgatgcagatcgagtgcgaggtcatggacaccagggtgattcac
atcaagacctccaccgtgcccccctcactccgaaagcagccatccccagccccgggcaat
gccacgggcggccccctgccagcttctgcggccagccaggcccaccgcagctcccgggag
cccctctacctcagccacccctga

DBGET integrated database retrieval system