KEGG   Heterocephalus glaber (naked mole rat): 101716738
Entry
101716738         CDS       T02812                                 

Gene name
Rela
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01523  Antifolate resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04137  Mitophagy - animal
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04218  Cellular senescence
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04623  Cytosolic DNA-sensing pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04668  TNF signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04917  Prolactin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04926  Relaxin signaling pathway
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05010  Alzheimer disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05030  Cocaine addiction
hgl05132  Salmonella infection
hgl05133  Pertussis
hgl05134  Legionellosis
hgl05135  Yersinia infection
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05203  Viral carcinogenesis
hgl05212  Pancreatic cancer
hgl05215  Prostate cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101716738 (Rela)
   04014 Ras signaling pathway
    101716738 (Rela)
   04064 NF-kappa B signaling pathway
    101716738 (Rela)
   04668 TNF signaling pathway
    101716738 (Rela)
   04066 HIF-1 signaling pathway
    101716738 (Rela)
   04071 Sphingolipid signaling pathway
    101716738 (Rela)
   04024 cAMP signaling pathway
    101716738 (Rela)
   04151 PI3K-Akt signaling pathway
    101716738 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101716738 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    101716738 (Rela)
   04218 Cellular senescence
    101716738 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101716738 (Rela)
   04621 NOD-like receptor signaling pathway
    101716738 (Rela)
   04622 RIG-I-like receptor signaling pathway
    101716738 (Rela)
   04623 Cytosolic DNA-sensing pathway
    101716738 (Rela)
   04625 C-type lectin receptor signaling pathway
    101716738 (Rela)
   04660 T cell receptor signaling pathway
    101716738 (Rela)
   04658 Th1 and Th2 cell differentiation
    101716738 (Rela)
   04659 Th17 cell differentiation
    101716738 (Rela)
   04657 IL-17 signaling pathway
    101716738 (Rela)
   04662 B cell receptor signaling pathway
    101716738 (Rela)
   04062 Chemokine signaling pathway
    101716738 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101716738 (Rela)
   04917 Prolactin signaling pathway
    101716738 (Rela)
   04926 Relaxin signaling pathway
    101716738 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101716738 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101716738 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    101716738 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101716738 (Rela)
   05202 Transcriptional misregulation in cancer
    101716738 (Rela)
   05203 Viral carcinogenesis
    101716738 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101716738 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101716738 (Rela)
   05221 Acute myeloid leukemia
    101716738 (Rela)
   05220 Chronic myeloid leukemia
    101716738 (Rela)
   05215 Prostate cancer
    101716738 (Rela)
   05222 Small cell lung cancer
    101716738 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101716738 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101716738 (Rela)
   05022 Pathways of neurodegeneration - multiple diseases
    101716738 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    101716738 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101716738 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101716738 (Rela)
   04931 Insulin resistance
    101716738 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101716738 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101716738 (Rela)
   05135 Yersinia infection
    101716738 (Rela)
   05133 Pertussis
    101716738 (Rela)
   05134 Legionellosis
    101716738 (Rela)
   05152 Tuberculosis
    101716738 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101716738 (Rela)
   05170 Human immunodeficiency virus 1 infection
    101716738 (Rela)
   05162 Measles
    101716738 (Rela)
   05164 Influenza A
    101716738 (Rela)
   05161 Hepatitis B
    101716738 (Rela)
   05160 Hepatitis C
    101716738 (Rela)
   05168 Herpes simplex virus 1 infection
    101716738 (Rela)
   05163 Human cytomegalovirus infection
    101716738 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101716738 (Rela)
   05169 Epstein-Barr virus infection
    101716738 (Rela)
   05165 Human papillomavirus infection
    101716738 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101716738 (Rela)
   05145 Toxoplasmosis
    101716738 (Rela)
   05140 Leishmaniasis
    101716738 (Rela)
   05142 Chagas disease
    101716738 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101716738 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101716738 (Rela)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101716738 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101716738
NCBI-ProteinID: XP_004852440
UniProt: A0A0P6J0K2
LinkDB
Position
Un
AA seq 548 aa
MDDLFPLIFPPEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDQSGRPLRLPPVLS
NPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADSSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFRSIMKKSPFNGPTDPRPPPRRIAMPSRSSTSVPKPAPQPYAFTSPLSTINF
DEFSPMVLPSGQIPSQASALTPAPVSVLAQNLVPAPPMAPTLPQAPAPVLAPCPPQAVAP
PAPKTTQSGEGTLSEALLHLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGV
SMPQPTVEPMLMEYPEAITRLVTGSQRPPDPAPTSMGASGLPNGLSGDEDFSSIADMDFS
ALLSQISS
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggacgacttgttccccctcatcttccccccagagccagcccaggcttctggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc
cgctcagcaggcagcatcccaggagagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagttcgcatctccctggtcaccaaggat
ccccctcaccggcctcacccccatgagctggtggggaaggactgccgggatggcttctat
gaggctgagctctgcccagaccgctgtatccacagcttccagaacctggggatccagtgt
gtgaagaagcgggacctggaacaggccatcagccagcgcatccagaccaacaacaatccc
ttccaagttcccatagaagagcagcgtggggactatgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggaccagtcaggcaggcccctccgcctgccgcctgttctctcg
aatcccatctttgacaaccgtgcccccaacacagctgagctcaagatctgcagagtgaac
cgaaactcagggagctgccttggtggggatgagatcttcctactgtgcgacaaagtgcag
aaagaggacattgaggtgtattttaccggaccaggctgggaggcccgaggctccttttcc
caagctgacgtgcaccggcaagtggccattgtgttccggacacctccctacgccgactcc
agcctgcaggcccctgtgcgagtctccatgcagcttcggcggccttctgacagggagctc
agcgagcccatggagttccagtacctgccggacacagatgaccgtcaccgaattgaggag
aagcgcaaaaggacatacgagaccttcaggagcatcatgaagaagagtcctttcaatgga
cctactgatccccggcctcctccccgacgcattgctatgccttctcgaagttcaacttct
gtccccaagccagccccccagccctatgcctttacatcacccctcagcaccatcaacttt
gatgagttttcccccatggtgttaccttctgggcagatcccaagccaggcctcagcctta
acaccagcccctgtctctgtcctggcccagaacctggtccctgccccccccatggcacca
actctgccccaggccccagcaccagtcctagccccatgccctccccaagctgtggcccca
cctgccccaaagaccactcagtccggggaaggtacgctgtcggaggccctgctgcacctg
cagtttgatgctgatgaagacctgggggccttgcttggcaatagcacagacccagctgtg
ttcacagacctggcttctgtcgacaactcagagtttcagcagctgctgaaccaaggtgta
tccatgccccaacccacagttgagcccatgctgatggagtatcctgaagctataactcgc
ctggtgacaggttcccagaggccccctgatccagctcccacctccatgggagcttcaggg
ctccccaatggcctctcgggggatgaagacttctcctccattgcggacatggacttctca
gcccttctgagtcagatcagctcttaa

DBGET integrated database retrieval system