KEGG   Heterocephalus glaber (naked mole rat): 101716902Help
Entry
101716902         CDS       T02812                                 

Gene name
Wbscr17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00512  Mucin type O-glycan biosynthesis
hgl01100  Metabolic pathways
Module
hgl_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101716902 (Wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101716902 (Wbscr17)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101716902 (Wbscr17)
Glycosyltransferases [BR:hgl01003]
 O-Glycan biosynthesis
  Mucin-type
   101716902 (Wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101716902
NCBI-ProteinID: XP_004840062
UniProt: A0A0P6J3Q4
LinkDB All DBs
Position
Un
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGRGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRGCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgctggtgttgaacttgatcgccgtggccggc
ttcgtgctcttcctggccaagtgccggcccatcgctgtgcgcagcggagacgccttccac
gagatccgaccgcgcgccgaggccgccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcggctctcgctgctcgaggacatcgtctaccggcagctgaatggt
ttatccaaatcccttgggctcattgaaggttatggtggacggggaagagggggccttcct
gccaccctttccccagcggaagaagaaaaagccaagggaccccatgagaagtatgggtac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccacc
aagtgcaaggagctcaagtactccaaggagctgccccagatctccatcatatttatcttc
gtgaatgaggccctgtcggtcatcctgcggtcagtccacagcgccgtcaatcacacgccc
actcatctgctgaaggaaatcatcctggtggatgacaacagcgacgaagaagagctgaag
gcaccattggaggagtacgtccacaaacgctaccctgggctggtgaaggtggtgcgcaat
cagaagagagagggcctgatccgagctcgcatagaaggctggaaggtggccactggtcag
gtcactggcttcttcgatgcccacgtggaattcactgctggctgggctgagccagttcta
tcccgcatccaggagaaccggaagcgagtgatccttccctccattgacaacatcaagcag
gacaattttgaggtgcaacgctacgagaactcagcccatgggtacagctgggagctgtgg
tgcatgtacatcagccccccaaaagactggtgggatgctggagacccttctctccccatc
agaacacctgccatgattggctgctccttcgtggtcaacaggaagttctttggtgaaatt
ggtcttctggaccctggaatggatgtgtatggaggagaaaatatcgagcttggaatcaag
gtgtggctttgtgggggcagcatggaggtccttccttgctcacgcgtggcccacattgag
cggaagaagaagccatacaacagcaacattggcttctacaccaagagaaatgctctccgg
gttgcggaggtctggatggatgattacaagtctcatgtgtacatcgcgtggaacctgccg
ctggagaatccggggattgacataggcgatgtctctgaaagaagagcattaaggaaaagt
ctgaagtgtaagaatttccagtggtacctggaccatgtctacccagaaatgagaagatac
aataacaccattgcttacggagagcttcgcaacaacaaggcaaaagatgtctgcttggac
caggggccgctggagaaccacacagccatcctgtacccatgccatggctggggaccgcag
ctcgcccgatataccaaggaaggcttcctgcacttgggcgccctggggaccaccacactc
ctgcctgacacccgctgcctggtggacaactctaagagtcggctcccccagctcctcgac
tgtgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaacggagccatc
atgaataagggcacagggcgctgcctggaggtggagaaccggggcctggctggcattgac
ctcatcctccgaggctgcacaggacagaggtggacaattaagaactccatcaagtag

DBGET integrated database retrieval system