KEGG   Heterocephalus glaber (naked mole rat): 101717129
Entry
101717129         CDS       T02812                                 

Gene name
Cacna1c
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04020  Calcium signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04260  Cardiac muscle contraction
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04270  Vascular smooth muscle contraction
hgl04713  Circadian entrainment
hgl04720  Long-term potentiation
hgl04723  Retrograde endocannabinoid signaling
hgl04724  Glutamatergic synapse
hgl04725  Cholinergic synapse
hgl04726  Serotonergic synapse
hgl04727  GABAergic synapse
hgl04728  Dopaminergic synapse
hgl04742  Taste transduction
hgl04911  Insulin secretion
hgl04912  GnRH signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04924  Renin secretion
hgl04925  Aldosterone synthesis and secretion
hgl04927  Cortisol synthesis and secretion
hgl04929  GnRH secretion
hgl04930  Type II diabetes mellitus
hgl04934  Cushing syndrome
hgl04935  Growth hormone synthesis, secretion and action
hgl05010  Alzheimer disease
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05031  Amphetamine addiction
hgl05410  Hypertrophic cardiomyopathy
hgl05412  Arrhythmogenic right ventricular cardiomyopathy
hgl05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101717129 (Cacna1c)
   04020 Calcium signaling pathway
    101717129 (Cacna1c)
   04024 cAMP signaling pathway
    101717129 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    101717129 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101717129 (Cacna1c)
   04929 GnRH secretion
    101717129 (Cacna1c)
   04912 GnRH signaling pathway
    101717129 (Cacna1c)
   04921 Oxytocin signaling pathway
    101717129 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    101717129 (Cacna1c)
   04924 Renin secretion
    101717129 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    101717129 (Cacna1c)
   04927 Cortisol synthesis and secretion
    101717129 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101717129 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    101717129 (Cacna1c)
   04270 Vascular smooth muscle contraction
    101717129 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    101717129 (Cacna1c)
   04727 GABAergic synapse
    101717129 (Cacna1c)
   04725 Cholinergic synapse
    101717129 (Cacna1c)
   04728 Dopaminergic synapse
    101717129 (Cacna1c)
   04726 Serotonergic synapse
    101717129 (Cacna1c)
   04720 Long-term potentiation
    101717129 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    101717129 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    101717129 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101717129 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101717129 (Cacna1c)
   05020 Prion disease
    101717129 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    101717129 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    101717129 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101717129 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101717129 (Cacna1c)
   05414 Dilated cardiomyopathy
    101717129 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101717129 (Cacna1c)
   04934 Cushing syndrome
    101717129 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hgl04040]
    101717129 (Cacna1c)
Ion channels [BR:hgl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101717129 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101717129
NCBI-ProteinID: XP_012924364
LinkDB
Position
Un
AA seq 1890 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEEDPSPCALESGHGR
QCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIY
FVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEEKPRNRGAQASLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENV
AGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEAVEKPAVEETKEEKIELKSITADGESPPTKINVDDLQHNENEDKSPYPNP
DAAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDQPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNNAEENSRISITFFRLF
RVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTT
EINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSF
AVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGR
IKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALR
IKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKF
KKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAAS
EDDIFRRAGGLFGNHVSYYQSDSRSTFPQTFTTQRPLHINKAGSNQGDTESPSHEKLVDS
TFTPSSYSSTGSNANINNANNTALGRFPHPAGYASTVSTVEGHGPPSSPAAWAQETTRKL
GTMRCHSRESQIAVVCQEEASQDKTYDVELNENAEYRSEPTLLSTEMLTYQDDENRQLTP
PEEDKRDTRPSPKRGFLRSASLGRRASFHLECLKRQKNHGGDISQKTVLPLHLVHHQALA
VAGLSPLLQRSHSPTTFPRPSATPPATPASRAWAPQPIPTLRLEGAESSEKLNSSFPSIH
CSSWSEDASPCGGGSSTARRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFA
QDPKFIEVATQELADACDMTIEEMENAADNILSGGGPQSPNGTLLPFVNCRDPGQDRAGG
GDEDEGCARALGRGRSEEELADSRVHVRSL
NT seq 5673 nt   +upstreamnt  +downstreamnt
atggtgcccctgctgcacatcgccctgcttgtgctgttcgtcatcatcatctatgcgatc
atcggcctggagctcttcatggggaagatgcataaaacatgctacaaccaggagggcatt
gcagacgttccagcagaagaggacccctccccctgtgctcttgagagtggccacgggcgg
cagtgccagaatggcacggtgtgcaagcccgggtgggatgggcccaagcacggcatcacc
aacttcgacaactttgccttcgccatgctcacagtgttccagtgcatcaccatggagggc
tggaccgacgtgctatactgggtcaatgatgccgtaggaagggactggccctggatctat
tttgttacactaatcatcatagggtcattttttgtacttaacttggttctcggtgttctt
agcggagagttttccaaagagagagagaaggccaaggctcggggagatttccagaagctt
cgagagaaacaacagctggaggaagatctcaaaggctacctcgactggatcactcaggca
gaagacatcgacccagagaatgaagacgaaggcatggatgaggagaaaccccgaaacaga
ggcgctcaggcgagcttgctggatcagaagaaaggaaagtttgcttggtttagtcactcc
acagaaacccatgtgagcatgcccacgagtgagaccgagtccgtcaacactgaaaacgtg
gccggaggtgacatcgaaggagagaactgtggggcgaggctggcccaccggatctccaaa
tcaaagttcagccgctactggcgcaggtggaatcggttctgcagaagaaagtgccgtgct
gcagtcaagtccaatgtcttctactggctggtgatcttcctggtgttcctcaatacactt
actattgcctcggaacattacaaccagccccactggctcacggaagtgcaagacacagcc
aataaggccctgctggccctgtttactgcggagatgctcctgaagatgtacagcctgggc
ctgcaggcctacttcgtgtccctcttcaaccgcttcgactgcttcatcgtgtgtgggggc
atcctggagaccatcctggtggagaccaagatcatgtctcccctgggcatctctgtgctg
agatgtgtgcggctactgaggatatttaaaatcacaaggtactggaactccttaagcaac
ctggtagcatccttgctgaactctgtgcgctccatcgcctccctgctcctactcctcttc
ctctttatcatcatcttctccctgctgggaatgcagctctttggaggaaagttcaacttt
gatgagatgcagacccggaggagcacattcgataacttcccccagtccctcctcactgtg
tttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgt
ggaaattatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgct
gagagcctcacttctgcccaaaaggaggaagaagaagagaaggagagaaagaagctggcc
aggactgccagcccagagaagaaacaggaggcagtggagaagccagcagtggaggagacc
aaggaggagaaaattgagctgaaatccattactgctgatggggagtccccacccaccaag
atcaacgtggatgacctccagcacaatgaaaatgaggacaagagtccctaccccaaccca
gacgctgcaggagaagaggatgaggaggagcctgagatgcctgtcgggccccgtccacga
ccactctctgagctacaccttaaggaaaaagccgtgcccatgccagaagccagcgcattt
ttcatctttagccctagcaacaggtttcgcctccagtgccaccgcattgtcaatgacacg
atcttcaccaacctgatcctcttcttcatcctgctcagcagcatttctctggctgcggag
gaccccgtacagcacacctccttcaggaaccatatcctaggcaacgcagactatgtcttc
actagtatctttaccttagagattatcctgaagatgactgcgtatggggctttcctacac
aagggctctttctgccggaactacttcaacatcttggacctgctggtggtcagcgtgtcc
ctcatctcctttggcatccagtccagtgcaatcaatgtggtgaagatcttgcgagtcctt
cgagtcctccggcccctgagggccatcaacagggctaaggggctaaagcacgtggtccag
tgtgtgtttgttgccatccggactatcgggaatatcgtcattgtcaccacactgctgcag
ttcatgtttgcctgcatcggggtccagctgttcaagggaaagctctacacctgctctgat
agttccaaacagaccgaggcagaatgcaagggtaactacatcacatacaaagacggggag
gttgaccaacctatcatccagccccgcagctgggagaacagcaagtttgacttcgacaat
gtcctggcagctatgatggccctcttcaccgtctccacctttgaggggtggccagagctg
ctgtaccgctccatcgactcccacacggaagacaagggtcccatctacaactaccgtgtg
gagatctccatcttcttcattatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcatcgtcaccttccaggagcagggagaacaagagtacaagaactgt
gagctggacaagaaccagcggcagtgtgtggagtatgccctcaaggcccggcccctgcgc
cggtacatccccaagaaccagcaccagtacaaggtgtggtatgtggtcaactccacctac
tttgagtacctgatgttcgtcctcatcctgctgaacaccatctgcttggccatgcagcac
tacggccagagctgcctgttcaaaatcgccatgaacatcctcaacatgctcttcactggc
ctcttcactgtggagatgatcctgaaactcattgccttcaaacccaagggttactttagt
gatccctggaatgtttttgacttcctcatcgtgattgggagcataattgatgtcattctc
agtgagactaataacgcagaggaaaactcccgcatctccatcaccttcttccgcctcttc
cgggtcatgcgcctggtcaagctgctgagccgcggggagggcatccggacactgctgtgg
accttcatcaagtcctttcaggccttgccctatgtggcccttctaatagtgatgctgttc
ttcatctacgccgtgattggcatgcaggtgtttggaaagattgccttgaatgacaccacc
gagatcaaccggaacaacaactttcagaccttcccccaagccgtgctgctgctgttcagg
tgtgccacaggggaggcctggcaggacatcatgctggcctgcatgccaggcaagaaatgc
gccccagagtccgagcccagcaatagcacggaaggagagacgccctgcggcagcagcttt
gctgtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcaacctcttt
gtagccgtcatcatggacaactttgactacctgacgagagactggtcaatccttggtccc
caccatctagatgaatttaaaagaatctgggcagaatatgaccccgaagccaagggtcgt
atcaaacacctggatgtggtgaccctcctccgacggattcagcctcctctgggctttggg
aagctgtgtcctcaccgtgtggcctgcaaacgcctcgtctccatgaacatgcctctgaac
agtgatgggacagtcatgttcaatgccactctgtttgccctggtcaggacagccctgagg
atcaaaacggaaggaaacctagaacaagccaacgaggagctgcgtgcgatcatcaagaag
atctggaagcggaccagcatgaagctgctggaccaagtggtgccccctgctggtgatgat
gaggtcacagttggcaagttctacgctactttcctgatccaagagtacttccggaaattc
aagaagcgaaaagagcaagggcttgtgggcaagccctcccagaggaacgctctgtccctg
caggctggcttgcgcacactgcacgacatcgggcctgaaatccgacgagccatctctgga
gatctgactgccgaggaagagctagacaaggccatgaaggaagctgtgtctgctgcctct
gaagatgacatcttcaggagggccggtggtctgttcggcaaccacgtcagctactaccaa
agcgacagccggagcaccttcccccagaccttcaccacccagcgcccactgcacatcaac
aaggcgggcagcaaccaaggcgacactgagtcgccctcccatgagaagctggtggactcc
accttcacccccagcagctactcgtccactggctccaacgccaacatcaacaacgccaac
aacactgccctgggccgcttcccccatcccgccggctacgccagcacagtcagcactgtg
gagggccacgggcccccctcatctcctgccgcctgggcacaggagaccacaaggaagctc
ggcaccatgaggtgccactcccgggagagccagatagctgtggtatgtcaggaggaggct
tctcaggacaagacctatgacgtggagctgaatgaaaatgctgaataccgcagcgagccc
accctgctctccacagagatgctcacctaccaggatgatgaaaatcgacaactgacaccc
cccgaggaagacaagagggacacccggccctctccaaagaggggtttcctccgctctgcc
tccctaggtcgaagagcctccttccacctggagtgtttaaagcgacagaagaatcacggg
ggtgacatttctcagaagacagtcttgcccttgcacctggttcatcatcaggcgctggcc
gtggccggcctgagccccctcctccagagaagccattccccgaccacgttccccaggccg
agcgccacgccccccgccacgcccgcgagccgagcctgggccccgcagcccatccccacc
ctgcggctagagggcgccgagtccagcgagaaactcaacagcagcttcccgtccatccac
tgcagctcctggtcagaggatgccagcccctgtggcgggggcagcagcacagcacggaga
gcccggcccgtctccctcatggtgcccagccaggccggggccccggggagacagttccac
ggcagtgccagcagcctggtagaggcggtcttgatttcagaaggactgggtcagtttgct
caagatcccaagttcatcgaggtcgcaacccaggagctggctgacgcctgcgatatgacc
atagaggagatggagaacgcagccgacaacatcctcagcgggggcggccctcagagcccc
aacggcaccctcttaccttttgtgaactgcagggacccagggcaggaccgggcgggcggc
ggcgacgaggacgagggctgtgcgcgcgccctggggcgcggccggagcgaggaggagctc
gcggacagcagggtccacgtccgcagcctgtag

DBGET integrated database retrieval system