KEGG   Heterocephalus glaber (naked mole rat): 101717932
Entry
101717932         CDS       T02812                                 

Gene name
Stam
Definition
(RefSeq) signal transducing adaptor molecule
  KO
K04705  signal transducing adaptor molecule
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04144  Endocytosis
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101717932 (Stam)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101717932 (Stam)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101717932 (Stam)
Membrane trafficking [BR:hgl04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101717932 (Stam)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10 GGA_N-GAT
Other DBs
NCBI-GeneID: 101717932
NCBI-ProteinID: XP_004860022
LinkDB
Position
Un
AA seq 539 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALIAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQTTTLSTLYPSTSNLLTNHQHDGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVEMIEPEPEAT
FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSEFSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYMQSSGVSGAQVCPGPPQSGAYLVAGSA
QMSHLHSYSLPPEQLSSLSQGAVPPPTSPALPSQQTTASYPNAMVSSVQGTTYPNQAAMY
SPPPAAAAVAADVTVYQSAGTGMSQVPNYTLTSSALPQPGASQQPPPPQQQLYSQKALL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcctttcgaccaggacgttgagaaagcaaccagcgagatg
aacactgctgaggactggggcctcatcctggatatttgcgataaggtcggccaatcccgc
actggacctaaagattgtcttcggtctattatgaggagggtgaaccacaaagatcctcat
gttgctatgcaagcattgactcttctaggagcctgtgtatcaaactgtggcaaaattttt
cacttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtgtgtgagaagttaaaagctcttatggtggaatggacggatgaatttaag
aacgacccgcagcttagtctgatatcagcaatgattaagaaccttaaagagcaaggagtc
actttcccagctattggctctcaggctgcagaacaggccaaagcaagcccagctctcata
gccaaggatcctggaactgtggctaacaaaaaagaagaagaagatttagcaaaagccatc
gagttgtctctcaaggagcaaaggcagcagaccactaccctttccactctgtatccaagc
acatccaaccttttaaccaaccaccaacatgacggtcggaaagttcgtgccatatatgac
tttgaagctgctgaagataatgaacttacttttaaagctggagaaattatcacagttctt
gatgacagtgatccaaactggtggaaaggtgaaacccatcagggcatcgggttatttccc
tctaattttgtaactgcggatctcactgctgaaccggaaatgattaaaacagagaagaag
acagtgcaatttagtgatgatgtccaggtagagatgatagagccagagccggaagcaact
tttatcgacgaagataaaatggaccagttgttacagatgttgcaaagtacagatcccagt
gataatcagccagatctgccagaactacttcaccttgaagcgatgtgtcaccagatgggg
cctctcattgatgaaaagctggaagacattgatagaaaacattcagaattctcagaactt
aatgtcaaagtgatggaggcgctttcattgtatacgaagttaatgaatgaagatccaatg
tattccatgtatgcaaaattacagaatcagcagtattacatgcagtcatctggtgtgtct
ggtgctcaggtctgtcccgggcctcctcagagcggtgcctacctggtggcagggagtgca
cagatgagccatctgcacagctacagccttcccccggagcagctgtcttctctcagccag
ggcgctgtcccgccgcccacaagcccagcccttcctagccagcagaccacggcttcctac
cccaatgccatggttagttctgttcaaggaaccacgtatcccaaccaggctgcaatgtat
agtcctcctcctgctgctgctgctgtcgctgctgacgtcacagtctaccagagtgcagga
actggtatgtcccaggtgccaaactatactctgacgtcttccgccctgcctcagccagga
gccagccaacagccacccccgccgcagcagcagctgtattctcagaaggctctgctatag

KEGG   Heterocephalus glaber (naked mole rat): 101722782
Entry
101722782         CDS       T02812                                 

Gene name
Stam2
Definition
(RefSeq) signal transducing adaptor molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04144  Endocytosis
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101722782 (Stam2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101722782 (Stam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101722782 (Stam2)
Membrane trafficking [BR:hgl04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101722782 (Stam2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH SH3_10
Other DBs
NCBI-GeneID: 101722782
NCBI-ProteinID: XP_004870077
LinkDB
Position
Un
AA seq 524 aa
MSLFAANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPR
VALQALTLLGACVANCGKIFHLEVCSRNFATEVHAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGVTFPPANSQTVSASAKNGVSLNKNKEDEDIAKAIELSLQE
QKQQCTETKSLYPSAEIQLNNRVARKVRALYDFEAAEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIESEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA
LQMLQSIDPADSKPDSQELLDLEDICQQMGPLIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLVNEAPVYSVYSKLHPSAHYPSTSAGAPLQTYPIQSHGGNYMGQSLHQVTATQSYSL
GPDHISSLRSLPSNMNSSVTTQPAQTPYLSTGQDTASNPYMNQNSNLPSATGTTAFTQQM
GMSVDMSVYQNTTCSLPQLAGFPVAVPAPSVAQQQTNYHQQPLL
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctctattcgccgccaaccccttcgagcaggacgtagaaaaagctacaaatgaatac
aatactacggaagattggagtcttattatggacatatgtgacaaagttggaagcactcct
aatggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcgt
gttgctctgcaagcattaactcttcttggggcttgtgtggctaactgtggaaagatattt
catttagaagtatgttcccgtaattttgcaacagaagtacatgctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactgaaatctttaatggtggaatggtcagaagaattt
cagaaggaccctcaatttagtctaatatctgcaactattaaatcaatgaaagaagaagga
gttacttttcctccagcgaattctcagactgtctctgcttctgccaagaatggagtatca
ttgaacaaaaacaaagaagacgaagacatagctaaagctattgaattatcattgcaagag
cagaaacagcagtgcacagagacaaaatctttatatccatctgcagaaattcagttaaac
aatagggttgcacgaaaagtgagagctttatacgattttgaagccgctgaggacaatgaa
ctcacctttaaacatggtgaaattattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggactcttcccatctaattttgtgacaactaattta
aacatagagtctgaagcagcagctgtggacaaattgaatgtaattgatgatgatgtggag
gaaattaagaaatcagaacctgagcctgtttatatagatgaggataagatggatagagcc
ctgcagatgctccagagtatagatccagctgattcaaaaccagattcccaagaactcttg
gatttggaagatatctgccaacaaatgggtccactgatagatgaaaaacttgaagagatt
gacaggaagcattctgaattatctgaattgaatgtaaaagtcttggaagctctggaactg
tataacaaactggtgaatgaagcaccagtatattcagtctactcgaagctccacccttca
gcacattacccctctacatcagctggggctccattgcagacatacccaattcaatcacat
ggtggaaactacatgggtcaaagtcttcaccaagtaactgctacccaaagttacagccta
ggaccagatcatattagttcattgcggtctctgccttcaaacatgaattcctcagtaaca
acgcagcctgcacaaactccatatttaagcaccggacaagacacagcgtccaatccttac
atgaaccagaactctaacctgccatcagctactggtacaactgctttcacacagcagatg
gggatgtccgtggatatgtcagtttaccagaacactacttgcagtttaccacaactggcg
ggctttccggtggcagttccagctccatccgttgcacagcaacaaacaaattaccatcag
cagcctctcctttaa

KEGG   Heterocephalus glaber (naked mole rat): 101723984
Entry
101723984         CDS       T02812                                 

Definition
(RefSeq) signal transducing adapter molecule 2-like
  KO
K04705  signal transducing adaptor molecule
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04144  Endocytosis
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101723984
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101723984
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101723984
Membrane trafficking [BR:hgl04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101723984
SSDB
Motif
Pfam: VHS SH3_1 SH3_2 SH3_9 UIM GAT ENTH
Other DBs
NCBI-GeneID: 101723984
NCBI-ProteinID: XP_012924205
LinkDB
Position
Un
AA seq 522 aa
MSLFAANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPR
VALQALTLLGACVANCGKIFHLEVCSCNFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
HKDPQFSLISAIKSMKEERVTFPPANSQTVSAAAKNGISLNKNKEDKDIAKAIELSLQEQ
KQQCTETKSLYPSAEIQLNNRVARKVRAIYDFEAIEDNELTFKHGEIXIVLDDSDANWWK
GENHRGIGLFSSNFVTTNLNTESEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRAL
QMLQSIDPADSKPDSQELLDLEDICQQMGPLIDEKLEETDRKHSELSELNIKVLEALELY
NKLVNEAPVYSVYSKLHPSAHYPSTSSGAPLQTYPIQSHGGNYMGQSLHQITATQSYILG
PDHISSLWSLPPNMNSSVTTQPAQTPYLSTGQDTVSNPYMNQNSNFPSATGTTAFTQQMG
MSVDMSVYQNTTCSLQLAGFLVAVPAPSVAQQQTNYHQQPLL
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtctctattcgccgccaaccccttcgagcaggacgtagaaaaagctacaaatgaatac
aataccacagaagattggagtcttattatggacatatgtgacaaagttggaagcactcct
aatggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcgt
gttgctctgcaagcattaactcttcttggggcttgtgtggctaactgtggaaagatattt
catttagaagtatgttcctgtaattttgcaacagaagtacgtgctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactgaaatctttaatggtggaatggtcagaagaattt
cacaaggaccctcaatttagtctaatatctgctattaaatcaatgaaagaagaaagagtt
acttttcctccagcgaattctcagactgtctctgctgctgccaagaatggaatatcattg
aacaaaaacaaagaagacaaagacatagctaaagctatcgaattatcattgcaagaacag
aaacagcagtgcacagagacaaaatctttatatccatctgcagaaattcagttaaacaat
agggttgcacgaaaagtgagagccatatacgattttgaagccattgaggacaatgaactc
acctttaaacatggtgaaattnatattgttttggatgacagtgatgccaattggtggaaa
ggagaaaatcacagaggaataggactcttctcatctaattttgtgacaactaatttaaac
acagagtctgaagcagcagctgtggacaaattgaatgtaattgatgatgatgtggaggaa
attaagaaatcagaacctgagcctgtttatatagatgaggataagatggatagagcccta
cagatgctccagagtatagatccagctgattcaaaaccagattcccaagaactcttggat
ttggaagatatctgccaacaaatgggtccactgatagatgaaaaacttgaagagactgac
aggaagcattctgaattatctgaattgaatataaaagtcttggaagctctggaactgtat
aacaaactggtgaatgaagcaccagtatattcagtctactcgaagctccacccttcagca
cattacccctctacatcatctggggctccattgcagacatacccaattcaatcacatggt
ggaaactacatgggtcaaagtcttcaccaaataactgctacccaaagttacatcctagga
ccagatcatattagttcattgtggtctctgcctccaaacatgaattcctcagtaacaaca
cagcctgcacaaactccatatttaagcaccggacaagacactgtgtccaatccttacatg
aaccagaactctaactttccatcagctactggtacaactgctttcacacagcagatgggg
atgtccgtggatatgtcagtttaccagaacactacttgcagtttacaactggcgggcttt
ctggtggcagttccagctccctccgttgcacagcaacaaacaaattaccatcagcagcct
ctcctttaa

DBGET integrated database retrieval system