KEGG   Heterocephalus glaber (naked mole rat): 101718090
Entry
101718090         CDS       T02812                                 

Gene name
Tgfbr1
Definition
(RefSeq) transforming growth factor beta receptor 1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04068  FoxO signaling pathway
hgl04144  Endocytosis
hgl04218  Cellular senescence
hgl04350  TGF-beta signaling pathway
hgl04371  Apelin signaling pathway
hgl04380  Osteoclast differentiation
hgl04390  Hippo signaling pathway
hgl04520  Adherens junction
hgl04659  Th17 cell differentiation
hgl04926  Relaxin signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05142  Chagas disease
hgl05161  Hepatitis B
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05220  Chronic myeloid leukemia
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101718090 (Tgfbr1)
   04350 TGF-beta signaling pathway
    101718090 (Tgfbr1)
   04390 Hippo signaling pathway
    101718090 (Tgfbr1)
   04371 Apelin signaling pathway
    101718090 (Tgfbr1)
   04068 FoxO signaling pathway
    101718090 (Tgfbr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101718090 (Tgfbr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101718090 (Tgfbr1)
  09143 Cell growth and death
   04218 Cellular senescence
    101718090 (Tgfbr1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101718090 (Tgfbr1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101718090 (Tgfbr1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101718090 (Tgfbr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101718090 (Tgfbr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718090 (Tgfbr1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101718090 (Tgfbr1)
   05212 Pancreatic cancer
    101718090 (Tgfbr1)
   05225 Hepatocellular carcinoma
    101718090 (Tgfbr1)
   05226 Gastric cancer
    101718090 (Tgfbr1)
   05220 Chronic myeloid leukemia
    101718090 (Tgfbr1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101718090 (Tgfbr1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101718090 (Tgfbr1)
   05161 Hepatitis B
    101718090 (Tgfbr1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101718090 (Tgfbr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101718090 (Tgfbr1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101718090 (Tgfbr1)
Protein kinases [BR:hgl01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   101718090 (Tgfbr1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 101718090
NCBI-ProteinID: XP_004864998
LinkDB
Position
Un
AA seq 500 aa
MESAAAAPRHQLLLLMLVAAATTLLPGAKTLQCFCQLCTKDNYTCVTDGLCFVSVTETTD
RVIHNTMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTEKQSPGLGP
VELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYD
MTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWF
REAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMI
KLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATD
TIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHED
YQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARL
TALRIKKTLSQLSQQEGIKM
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggagtcggcggccgctgctccgcgtcaccagctgcttctcctcatgctggtggcggcg
gcgacgacgctgctcccgggggcgaagacattacagtgtttctgccagctctgtacaaaa
gacaattatacctgtgtgacagatgggctctgctttgtctctgtcacagagaccacagac
agagttatacacaataccatgtgtatagctgaaatcgatctaattcctcgagatagacca
tttgtatgtgcaccctcttcaaaaactggggctgtgactacaacatattgttgcaatcag
gatcattgcaataaaatagaactcccaactactgaaaagcagtcacctggccttggtccc
gtggagctggcagccgtcattgctggaccagtctgctttgtttgcatctcactcatgttg
atggtctatatctgccataaccgaactgttattcaccatcgagtgccaaatgaagaagat
ccttcattagatcgcccttttatttcagagggtactaccttaaaagatttaatttatgat
atgacaacgtcagggtctggatcaggtttaccattgcttgttcagagaacaattgcaaga
acaattgtgttacaagaaagcattggcaaaggtcgatttggagaagtttggcgaggaaag
tggcgaggagaagaagttgctgttaagatattctcctccagagaagaacgttcatggttc
cgtgaggcagagatttatcagactgtaatgttacgccatgaaaacatcctgggatttata
gcagcagacaataaggacaacggtacatggactcagctctggttggtgtcagattatcat
gagcatgggtccctttttgattacttgaatagatacacagttactgtggaaggaatgatc
aagcttgctctgtccacagcaagtggtcttgcccacctacacatggagatagttggtacc
caaggaaagccagccattgctcatagagatttgaaatcaaagaatatcttggtaaagaag
aatggaacctgctgtattgcagacttaggactggcagtaagacatgattcagctacggat
acaattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcccctgaagtt
ctagatgattccataaatatgaaacattttgaatcctttaaacgtgctgacatctatgca
atgggcttagtattctgggaaatagctcggcgctgctccattggtggaattcatgaagat
taccagctgccttactatgatcttgtaccttctgatccatcagttgaagaaatgagaaaa
gtagtttgtgaacagaagctgaggccaaatattccaaacagatggcagagctgtgaagcc
ctgagagtgatggctaaaattatgagagaatgttggtatgctaatggagcagctaggctg
acagctttgaggattaagaaaacattgtcacaactcagtcaacaggaaggcatcaaaatg
taa

DBGET integrated database retrieval system