KEGG   Heterocephalus glaber (naked mole rat): 101718580
Entry
101718580         CDS       T02812                                 

Gene name
Polk
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03460  Fanconi anemia pathway
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    101718580 (Polk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718580 (Polk)
   05202 Transcriptional misregulation in cancer
    101718580 (Polk)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101718580 (Polk)
   05212 Pancreatic cancer
    101718580 (Polk)
   05225 Hepatocellular carcinoma
    101718580 (Polk)
   05226 Gastric cancer
    101718580 (Polk)
   05214 Glioma
    101718580 (Polk)
   05216 Thyroid cancer
    101718580 (Polk)
   05220 Chronic myeloid leukemia
    101718580 (Polk)
   05217 Basal cell carcinoma
    101718580 (Polk)
   05218 Melanoma
    101718580 (Polk)
   05213 Endometrial cancer
    101718580 (Polk)
   05224 Breast cancer
    101718580 (Polk)
   05222 Small cell lung cancer
    101718580 (Polk)
   05223 Non-small cell lung cancer
    101718580 (Polk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101718580 (Polk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hgl03400]
    101718580 (Polk)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101718580 (Polk)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    101718580 (Polk)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone Put_Phosphatase
Other DBs
NCBI-GeneID: 101718580
NCBI-ProteinID: XP_004872931
LinkDB
Position
Un
AA seq 862 aa
MDTTKEKNDNYKDNLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYENELKKEKQV
NQRIENMMHQKTQITSQQLRNAQLQVDRFAMEIEHRRDLNNTIVHVDMDAFYAAVEMRDT
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPHLIIVAPNFDKYRAVSEE
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEEKRSYFIKTGNLAENDEPGKEVNK
LSESDRSISPLLFEDSPPDLQSPGHPCQVNSEEQNNPQIPQNSVVFGTSAEEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLARDGERKSMSVER
TFNEINKAEEQYDLCQELCRELAQDLQKEGLKGRTVTVKLKNVNFEVKTRASTVSSVVST
TEEIFAIAKELLRTEIDADFPYPLRLRLMGVRISSFPNEEDKKHQQRSIIGFLQAGNQAP
SATEYIEERTDKDQFVKPLKTSHKKSFFDKKQSETKWSHQDTSKCETVDKQNLQTSQPFQ
IIKKKTSENLETSESSNSCQMIFTCPVCFREQGSISLEAFNKHVDACLDCPSVSENCKVS
TCSQATSAVNQKENTHHSFSLWEKQDYEARQKNIEVTSEDCVDLVEPKDSSLKARSIDSL
RRKHSKEEHSSLPSKSSCTVSLENADVGLLSRQESLQPLSFKVTAGQALVCPVCSLEQKT
SDLTLFNEHVDVCLNKGIIQELRNDSVNTINEPEESSKSTGMSNKVQKTVAKTKRPGLMT
KYSTSKKIKPNNPRHTLDIFFK
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggataccacaaaggagaagaatgacaattacaaagataatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaataaaattata
atggaagccacaaaggggtccagattttatgaaaatgagctcaagaaggaaaaacaagtc
aaccaacgaattgaaaatatgatgcaccaaaaaacacaaatcaccagccagcagctaagg
aatgcacaattgcaggttgacaggtttgcaatggaaatagaacaccgccgagatttgaac
aataccatagtacatgttgacatggatgctttctatgctgctgtagaaatgagggacact
ccagaactgaaggataaacccatcgctgtaggatcaatgagtatgttgtctacttcaaat
taccatgcaaggaggtttggtgttcgtgcagccatgccaggatttattgctaagagactc
tgcccacatctcattatagtggccccaaactttgacaaatacagagccgtgagtgaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaggaaagacaaaattggcctgaggaaaaaagaagt
tatttcatcaaaactggaaacttggcagaaaatgatgaaccaggaaaggaagttaataag
ctgagtgagtctgaccggtccatctctccactactttttgaagacagtcctcctgatttg
cagtccccaggacatccttgccaagtgaactctgaagaacaaaacaatcctcaaatacca
cagaattcagttgtttttggaacttcagctgaggaagtggtaaaggaaattcggttcaga
attgaacaaaaaacaacactaacagccagtgcaggcattgctcccaacacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattctccccagcagacaa
gctgtgatggacttcatcaaagacttacccattcgaaaggtttctggaataggaaaagtt
acagagaaaatgttgaaggcccttggaattattacttgtacagaactctaccaacagagg
gcattgctttctctccttttctctgaaacatcttggcattattttcttcatatttctctg
ggcctaggttcaacccacctggcaagggatggagaaaggaaaagtatgagtgttgagagg
acatttaatgagataaacaaagcagaagaacagtacgatttgtgccaggaactttgcagg
gaacttgcccaagatctccagaaagaaggactaaagggtcgaactgttaccgttaaactg
aagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctacc
acagaagaaatatttgccattgcaaaagaattgctaagaacagaaattgatgctgatttt
ccatatcccttaagattaagacttatgggtgttcggatatctagttttcccaatgaagaa
gacaaaaaacaccaacaaaggagcatcattggcttcttacaggctgggaaccaagctcca
tcagccactgagtatatagaagagagaactgataaagatcagtttgtaaaacctctaaaa
acatctcataagaagagtttttttgataaaaaacaatcagaaacaaaatggagccaccaa
gacacatcaaaatgtgaaactgtggataaacaaaatttacagacatcacagccattccaa
attataaagaagaagacgagtgagaatttagaaacatcagagagttcaaatagctgtcag
atgatatttacgtgtcctgtttgctttagggagcaaggaagcatcagtctggaggccttt
aataaacatgtagatgcatgtctcgattgcccttcagtcagtgagaactgtaaagtgtcc
acttgttcacaggctacctctgctgttaaccagaaagaaaacacacatcattccttttca
ctttgggaaaagcaagattatgaggcccgtcagaaaaatatagaagtcacttcagaagat
tgtgtcgatttggtagagcctaaagatagctcactgaaagctagaagtatagactctcta
aggagaaagcacagcaaagaggagcattctagtcttccaagcaagtcttcttgtactgtt
tcattggaaaatgcagacgttgggttattaagtaggcaagaatccctccaacctttgtca
tttaaagtgacagctggccaagctctggtttgtcctgtttgtagtctagaacaaaagacc
tcagatcttaccctattcaatgagcacgtggatgtttgcttaaataaaggtattatccaa
gaactgagaaatgatagcgttaatacaatcaacgaacccgaagaaagctccaaaagtact
ggtatgtcaaacaaagtacagaagactgtagcaaaaacaaaaaggccaggactgatgaca
aagtactcaacatcaaagaaaataaaaccaaacaatcccagacatacccttgatatattt
tttaaatga

DBGET integrated database retrieval system