KEGG   Heterocephalus glaber (naked mole rat): 101718861Help
Entry
101718861         CDS       T02812                                 

Gene name
Gaa
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00052  Galactose metabolism
hgl00500  Starch and sucrose metabolism
hgl01100  Metabolic pathways
hgl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101718861 (Gaa)
   00500 Starch and sucrose metabolism
    101718861 (Gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101718861 (Gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101718861 (Gaa)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101718861 (Gaa)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101718861 (Gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101718861
NCBI-ProteinID: XP_004860937
LinkDB All DBs
Position
Un
AA seq 976 aa AA seqDB search
MAVLWAPCSRLLVGACTLISLATVVLLGHVLFCDFPVVPRELRDFPQGLEETAHAHQPGA
SGPEPWRAQKHPGQPGAAPAQCDIPPDSRFDCAPDKAVTQEQCEARGCCYVPARQHPGPP
LMGQPWCFFPSSYPSYRLQNLSSSEMGYTATLTRATPTFFPKDILTLQLDVLMETESRLH
FTIKDPADKRYEVPLETPRVHSRAPSPLYSVELSEEPFGVVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSRYITGLAEHLSPLILKTEWTRVTLWNRDLAPLPSANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGR
PFMPPYWGLGFHLCRWGYSSTAILRQVVQNMTRAHFPLDVQWNDLDYMDAQRDFTFNRDG
FADLPAAVHELHQGGRKYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKA
VTPQGPGARSGWGQVSPWPLAVQVWPGPTAFPDFTNPEALDWWQDMVSEFHAQVPFDGMW
IDMNEPSNFVRGSEHGCPDNELENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYG
LTEAMASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLSYSVAEILQFNL
LGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRNHNDLHSQPQEPYRFSEPAQQAMR
KAFALRYALLPYLYTLFHGAHVRGETVARPLFLEFPKDPSTWTVDRQLLWGQALLITPVL
EPGKTEVTGYFPSGTWYDLQMVPVEALGSLPLPPPKSPSPAIHSEGQWVTLPAPLDTINV
HLRAGTIVPLQAPGLTTTESRKQPMALAVALTPRGEAQGELFWDDGDSLGVLERGAYTQV
VFLAGNNTIVNQLLRLTKEGADLQLRKVTVLGVDTAPRQVLFNSVPVSDFTYSPDTKTLA
IPAALSMGKQFRISWA
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctgtgggcaccctgttcccggctgctggtgggggcctgcaccctcatctcc
ttggccacggttgtcctcctgggacacgtcctgttttgtgacttcccagtggtccctcga
gagctgcgagactttcctcaagggctggaagagactgcccacgctcaccagccaggagcc
agcgggccagagccctggcgtgcccagaaacaccctggccagcctggagcagcaccagca
cagtgtgacatccctcccgacagccgctttgactgtgcccctgacaaggctgtcacccag
gagcagtgcgaggcccgtgggtgctgctatgtcccagcaaggcagcaccctgggcccccc
ctgatggggcagccctggtgtttcttcccctccagctatccgagctaccgcctgcagaac
ctcagctcctcagagatgggctacacagcaaccctgacccgagctacccccaccttcttc
cccaaggacatcctgaccttgcagctggacgtgttgatggagacagagagccgcctgcac
ttcacgatcaaagaccccgccgacaagcgctacgaggtgcccttggagaccccgcgtgtg
cacagccgggcgccgtcccccctctatagcgtggagctctccgaggagcccttcggggtg
gtggtgcgcaggaagctggacggccgggtgctgctgaacaccaccgtggcacccctgttc
ttcgccgaccagtttctccagctatccacctccctaccctctcggtacatcactggcctt
gctgagcaccttagccccctgatactcaaaaccgaatggaccagggtcaccctctggaac
cgggacttggcccccttgcccagtgccaatctctatgggtcacaccctttctacctggct
ctggaggatggcggctcagcccatggagtcttcctgctgaacagcaatgccatggatgtg
gtcctgcagcccagcccagccctcacctggaggtcaacaggtgggatcctggatgtgtat
gtcttcctgggaccagagcccaagagcgtggtgcagcagtacctggacgtcgtggggcgc
cccttcatgccaccgtactggggcctgggctttcacctctgtcgctggggctactcctcc
actgccatcctccgccaggtggtacagaacatgaccagggcccacttccccctggatgtg
cagtggaacgacctggactacatggacgcacagagggacttcactttcaaccgggatggc
tttgcagacttgccagccgctgtgcacgagctccaccagggcggccggaagtacatgatg
attgtggatcctgccatcagcagctcaggccctgctggcagttatagaccctatgacgag
ggtctgcggaggggggttttcatcaccaatgagaccgggcagccactgattggaaaggct
gtgactccacagggccctggtgcacgctctggctggggccaagtctccccttggcctctc
gctgtccaggtatggcctggacccactgccttcccggacttcaccaaccccgaggccctt
gactggtggcaggacatggtgtccgagttccatgcccaagtgcccttcgacggcatgtgg
attgacatgaatgaaccgtccaactttgtgaggggttctgagcatggctgcccggacaac
gagctggaaaacccaccctatgtgccgggagtggtcggtgggaccctgcaggcagccact
atttgtgcctccagccaccagttcctgtccacacactacaacctccacaacctatatggc
ctgacagaagccatggcctcccacagggccctggtgaaggctcgggggacgcgccccttt
gtgatctcccgctcaacctttgctggccatggccggtacgccggccactggacgggagac
gtgtggagcagctgggagcagctttcctactctgtggcggaaatcctgcagtttaacctg
ctgggggtgcccctggttggggcagatatctgcggcttcctggggaacacctcggaggag
ctgtgtgtgcgttggacccagctaggagccttctatcccttcatgcgcaaccacaatgac
ctgcacagccagccccaggagccatacagattcagcgagcctgcgcagcaagccatgagg
aaagcctttgccctgcgctatgcactgctgccctacctctacactctgttccacggcgcc
cacgtcaggggcgagaccgtcgcccggcccctcttcctggagttccccaaggaccccagc
acctggaccgtggaccggcagctcctgtggggtcaggctctgctcatcacacctgtactc
gagcctgggaagactgaagtcaccggctacttcccctcgggcacgtggtatgacctgcag
atggtaccagtagaggccctgggcagcctcccgcttccgcccccaaagtcccccagccct
gccatccacagtgaggggcagtgggtgacgcttccggcccccctggacaccatcaatgtg
cacctgcgggctgggaccatcgtgcctctgcaggcccctggcctcacaaccacagagtcc
cgaaagcagcccatggccctggctgtggccctgaccccgcgtggtgaggcccagggggag
ctgttctgggacgatggggacagccttggggtgctggaacgcggggcctacacgcaggtc
gtcttcctggccgggaacaacaccattgtgaaccagctgctgcgcctgaccaaggagggg
gcggacctgcagctgaggaaagtgaccgtcctgggggtggacacggccccccggcaggtc
ctcttcaacagtgtccctgtctccgacttcacctacagtccagacaccaagaccctggcc
atccctgccgcgctgtccatggggaagcagttccgtatcagctgggcctag

DBGET integrated database retrieval system