KEGG   Heterocephalus glaber (naked mole rat): 101718902
Entry
101718902         CDS       T02812                                 

Gene name
Stat1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04062  Chemokine signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05140  Leishmaniasis
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05212  Pancreatic cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101718902 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101718902 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101718902 (Stat1)
   04621 NOD-like receptor signaling pathway
    101718902 (Stat1)
   04625 C-type lectin receptor signaling pathway
    101718902 (Stat1)
   04658 Th1 and Th2 cell differentiation
    101718902 (Stat1)
   04659 Th17 cell differentiation
    101718902 (Stat1)
   04062 Chemokine signaling pathway
    101718902 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101718902 (Stat1)
   04935 Growth hormone synthesis, secretion and action
    101718902 (Stat1)
   04919 Thyroid hormone signaling pathway
    101718902 (Stat1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101718902 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101718902 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101718902 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101718902 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101718902 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101718902 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101718902 (Stat1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101718902 (Stat1)
   05160 Hepatitis C
    101718902 (Stat1)
   05171 Coronavirus disease - COVID-19
    101718902 (Stat1)
   05164 Influenza A
    101718902 (Stat1)
   05162 Measles
    101718902 (Stat1)
   05168 Herpes simplex virus 1 infection
    101718902 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101718902 (Stat1)
   05169 Epstein-Barr virus infection
    101718902 (Stat1)
   05165 Human papillomavirus infection
    101718902 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101718902 (Stat1)
   05140 Leishmaniasis
    101718902 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101718902 (Stat1)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101718902 (Stat1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra DUF4407 BLI1
Other DBs
NCBI-GeneID: 101718902
NCBI-ProteinID: XP_004869016
LinkDB
Position
Un
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAATDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDSFQEDPVQMSMIIFNCLKEERKILENAR
RFNQAQSGNIQSTVMLDKHKELDCKVRNVKDQVMSIEQEIKTLEDLQDEYDFKCKTSQNR
EHETNGVAKNDQKQEQLLLHQMYLMLDNKRKEIIHKIRELLNATELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQGWFTVVAESLQQVRQQLKKLEELEQKFTYEQDPITKNKQG
LWDRTFALFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLVVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLCEVLSWQFSSVTKRGLSGDQLNMLGEKLLGPNAAPDGLIPWT
RFCKENINDKNFSFWLWIESILELIKKHLLSLWNDGCIMGFISKERERVLLKDQQPGTFL
LRFSESSREGAITFTWMERSQNGGEPEFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIMGPVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgagctccaacagctggactccaagttcctggagcaggtccaccag
ctctatgatgacagtttccccatggaaatcaggcagtacctggcccagtggctagaaaag
caagactgggagcatgcagccactgatgtgtcctttgccaccattcgcttccatgacctc
ctgtcgcagctggatgatcagtacagtcgcttctctttggagaataactttttgttgcag
cacaacataaggaagagcaagcgcaacctgcaggatagtttccaggaagacccagtacag
atgtctatgatcatctttaactgcctgaaggaggaacggaaaattttggaaaacgccagg
agatttaaccaggcccagtcggggaatattcagagcactgtgatgttagacaaacacaaa
gagcttgactgcaaagtcagaaatgtgaaggaccaagtcatgagtatagagcaggagatc
aaaaccctagaagatttacaagatgaatatgattttaaatgcaaaacctcgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgaccagaaacaagaacagctgttactccat
cagatgtatttaatgcttgacaataagagaaaggaaataattcacaaaatcagagagctg
ttgaatgccacagagctgacccagaacaccctcatcaatgacgagctggtggagtggaag
cggcggcagcagagtgcctgcatcggggggccgcccaacgcctgcctggaccagctgcag
ggctggttcaccgtggtggccgagagtctgcagcaggtgcggcagcagctcaagaagctg
gaggagctggagcagaagttcacctacgagcaggacccgatcaccaagaacaagcagggt
ctgtgggaccgcacctttgccctcttccagcagctcatccagagctcctttgtggtggaa
agacagccatgcatgccaacgcatccacagaggcctctggtcttgaagactggagtacag
ttcactgtaaagttgagactgttggtgaaattgcaagagctgaattataacttgaaagtg
aaagtcttatttgataaggatgtgaacgagagaaacacagtaaaggggttccggaagttc
aacatcctgggcacacacaccaaagtcatgaacatggaggagtccaccaacggcagcctg
gcggccgagttccggcacttgcaactgaaagaacagaagaacgctggcaacagaaccaac
gagggtcctctggttgttactgaagaacttcactcccttagcttcgaaacccagttgtgc
cagcctggcttggtcattgacctcgagacgacctcgctgcctgtggtggtgatctccaac
gtcagccagctgcccagcggctgggcctccatcctgtggtacaacatgctggtggcggaa
cccaggaacctgtctttcttcctgaacccaccctgtgcacggtggtcacagctctgcgag
gtgctgagttggcagttttcatccgtcaccaagaggggcctgagcggggaccagctgaac
atgctgggagagaagcttcttggtcctaatgctgccccggatggtctcatcccctggact
aggttttgtaaggaaaacatcaatgataaaaacttttccttctggctttggatcgaaagc
atcctagaactcattaaaaaacacctgctgtctctctggaacgacgggtgcatcatgggc
ttcatcagcaaggagcgggaacgcgtgctgctcaaggaccagcagcccgggaccttcctg
ctgcggttcagcgagagctcccgagagggcgccatcaccttcacctggatggagcgctcg
cagaacggaggtgaacccgagttccatgcggttgaaccctacaccaagaaagagctttct
gccgttactttccctgacatcatccgcaattacaaagtcatggctgcggagaatattcca
gagaaccccctcaagtacctatacccaaacattgacaaagaccacgcgtttggaaagtat
tactccaggccgaaagaagcaccagagccgatggagctcgatggccctaaaggaactggc
tacatcaagactgagttgatttctgtgtctgaagttcacccttctagacttcagaccaca
gacaacctgctccccatgtctcccgaggaattcgacgaagtgtcccggatcatgggcccc
gtggaatttgacagtatgatgaatgctgtataa

DBGET integrated database retrieval system