KEGG   Heterocephalus glaber (naked mole rat): 101718948Help
Entry
101718948         CDS       T02812                                 

Gene name
Atm
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01524  Platinum drug resistance
hgl03440  Homologous recombination
hgl04064  NF-kappa B signaling pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04210  Apoptosis
hgl04218  Cellular senescence
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05202  Transcriptional misregulation in cancer
hgl05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    101718948 (Atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101718948 (Atm)
   04068 FoxO signaling pathway
    101718948 (Atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101718948 (Atm)
   04210 Apoptosis
    101718948 (Atm)
   04115 p53 signaling pathway
    101718948 (Atm)
   04218 Cellular senescence
    101718948 (Atm)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101718948 (Atm)
   05206 MicroRNAs in cancer
    101718948 (Atm)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101718948 (Atm)
   05170 Human immunodeficiency virus 1 infection
    101718948 (Atm)
   05165 Human papillomavirus infection
    101718948 (Atm)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101718948 (Atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101718948 (Atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hgl03032]
    101718948 (Atm)
   03400 DNA repair and recombination proteins [BR:hgl03400]
    101718948 (Atm)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101718948 (Atm)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101718948 (Atm)
DNA replication proteins [BR:hgl03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101718948 (Atm)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    101718948 (Atm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC ANAPC5
Motif
Other DBs
NCBI-GeneID: 101718948
NCBI-ProteinID: XP_004856874
LinkDB All DBs
Position
Un
AA seq 3004 aa AA seqDB search
MSLALNNLLICCRQLENDRATERRKEVETFKRLIRDPEIVQDLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETECLRTAKPSVSVSTQTSRQKKMQEISSLVRFFIKCANKRGPRLKSQEL
LNYVMDTVKDSSSGVIYGSDCSNILLKDILSVRKYWCEISQQQWLELFSVYFRLYLKPSQ
DINRVLVARIIHVVTKGCCSQTDGINSKSLDFFSEAVQYARQEKKSAGLNYILAALIIFL
KTLAVNFRMRVCELGDEILPVLLYIWTQHILNDSLKGVIIELFQLQMYIHHPRGAKTHEK
GIRKIFVEDTRSLEISQSYTTTQRESDDYSVPCKRRKIEVGWEVIKDYLQKSQNDFDLVP
WLQITTQLISKYPASLPNCELCPLLMILYQLLPQQRRGERTPYVLRCLTEIALCQSKKSN
LESSQKSDLSKLWIKIWSVTFCGINSVQIQTENFGLLGAIIQGSLVEVDREFWKLFIGSA
CKPSSPAVCCLTLALTICVIPEVLKTRTEQNVYEVNRSFSLKESIIRWLLLRQSEDDLDS
KDLPPVLQSNFPHLILEKILVSLTMKNCKAAMNFFQCVPECEHHQKDKEELSFSEVEELF
LQTTFDKMDFLSILKECAVEKYQSSIGFSVHQNLKESLNHYLLGLSEQLLNNSSEITNSE
TLVQCSILLVGVLGCYCYVGIITEEEAYKSELFQKAKSLMQCAGESISLFKNKTNEEPRI
GSLRIMMCLSTSCLCNCSKQNPNKITSGFFLRLLTSKLMNDIADICKSLASFIKKPFDYG
EVKSVEDDTIENRNDVNYSSSTNLFHDYPSSSSANDADDPAENQSTIGAMNPLAEEYLSK
QDLLLLDMLKFLCMCVTASQTKSVSFRAADIRRRLLMLIDSSTLDLTKSLHLHMYLVLLK
ELPGEQYPLPMEDVVELLKPLSNLCSLYRRDQDVCKTILKHVLHIVTNLGQDSVDTENTK
EAQGQFLTVIGAFWHLTKEKKCTFSVRMAIVRCLKTLLEADPCSKWAILNVMGKGFPVNE
VFPQFLSDDNHQVRMLTAESINRLFQDMKQGDSSMLLKSLPLKLQKTAFENAYLKAWEGM
KEVSHDAENPELSDETYNRKSVFLMMIAVVLYCSPICEKQALFALCKSVKENGLDSHLVK
KVLKKVSETFGYRHLEDFMASHLDYLVSEWLNLQDSAYSLSSFPFILLNCSNVEDFYKSY
HNVLIPHLVIRSYFDEVKAIANQIQEDWKRLLIGCFPKILVNILPYFAYEGTGDGMAQQR
ETATKVYDMLKGENLLGKQIDHLFISNLPEIVVELLMTLHEPADFGASQSTDLCNFSGDL
DPAPNPPYFPSHVIKATFAYISNCHKTKRKSILEILSKSPDSYPKILLAICEQAAETNNV
YKKHRILKIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHHINQRTSRLMDVSLRSFS
LCCDLLSRVCQTAVTHCKDALENHLHVIVGTLIPLVNDQVKVQKQVLDLLKYLVIDNKDN
ENLYLTIKLLDPFPDHAIFKDLRITQQKIKYSRGSFSLLEEINHFLSVSVYDALPLTRLE
GLKDLRRQLEQHKDQMMNLMRASQDNPQDGIVVKLVVSLLQLSKMAVNHTGEKEVLEAVA
SCLGEVGPIDFSTIAIQHNKDTSYTKSLELFEDKELQWTLIILTYLNNTLVEDGVKVRSA
AVTCLKNILATKTGHNFWEIYKMTTDPMLTYLQPFRTSRKKFLEVSRLDKESPLEDLGDN
NLWIPQSENHDIWIKTLTCAILDSGGVKSEILQLLKPMCQVKTGFCQTVLPYLIHDILLQ
DINESWKNLLSTHVQGFFTNCFRHLSQTSRSTTPANLDSESELFSQCCLDKKSQRTMLAV
VDYLRRQKRPSSETVFEDAFWMDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSIDDQEK
RSLTFEEGSQSTSISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTR
LRTYEHEAMWEKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDNENKEWC
AELQELHYQTAWRNMQWDHCISVNKGIEGSGYHESLYNALQSLRDREFSTFFECLRYARV
KEVEELCKGSLESVYSLYPALSRLQAIGELENIGELFLRSVTDTQLSEVYVKWQKHSQLL
KDSDFSFQEPIMALRTIILEILMEKKMENSQRECFKDILTRHLVEFSILARTFKNTQLPE
RALFQIKQYNSTVCGISEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASFTESNPNLKL
MYTECLRVCGTWLAETCLENPAVIMQTYLEKAVQIAESYNGESNDKLRNGKMKAFLSLAR
FSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECAL
HALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVFEVNAMMKRDGMKIS
SYKFLPLMYQLAARMGTKTMGDLGFHEVLNNLISRITMDHPHHTLFIILALANANKDEFL
TKPEAARRSRITKNAPKQNSQLDEDRMEAANRIICTIRSKRPQMVKNVEALCDAYIILAN
LDATPWKTQRKGINIPADQPINKLKNLEDVVVPTMEIKVDPTGEYGNLVTIQSFKTEFRL
AGGLNLPKIIDCIGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNSETRKRKLTI
CTYKVVPLSQRSGVLKWCTGTVPIGEFLVNNEGGAHKRYRPMDFSAFQCQKKMMDVQKKS
FEEKYETFMDICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRH
VQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCE
KTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDENELHSTPSADDQQCK
RNLSDTDQSLNKVAERVLMRLQEKLKGVEEGTMLSVGGQVNLLIQQAMDPKNLSRLFPGW
KAWV
NT seq 9015 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgcacttaataacctgcttatttgttgccggcaactggaaaatgatagagct
acagaacgaaggaaagaagttgagacctttaagcgcctgattcgggatcctgaaatagtt
caagatttagatagacattcagattccaaacaaggaaaatacttaaattgggatgctgtt
ttcagatttttacagaaatatattcagaaagaaacagaatgtctgagaaccgcaaaacca
agtgtttccgtctcaacacaaacctccagacagaaaaagatgcaagaaatcagtagtttg
gtcagattcttcatcaaatgtgcaaataaaagaggacccaggctaaaatctcaagagctc
ttgaattatgtcatggatacagtgaaagattcatccagtggtgttatttatggatctgat
tgtagcaacatactgctcaaagacattctttccgtgaggaaatactggtgtgaaatatct
cagcaacagtggctcgaattgttctctgtgtacttcaggctatatctcaagccttcacaa
gacattaatagagttttagtggctagaataattcatgttgtgaccaaaggatgctgttca
caaactgatggaataaattctaaatctttagattttttttctgaggctgttcagtatgca
agacaagaaaagaaatctgcaggcctaaattatatcttggcagctcttattatctttctg
aagactttggctgtcaactttcgaatgcgagtgtgtgaattaggagatgaaattcttcca
gtgttattgtatatttggactcaacatatacttaatgattccttaaaaggagtaattatt
gagttgtttcagctgcaaatgtacatccatcatccaaggggagccaaaacccatgaaaaa
ggtataaggaaaatttttgttgaagataccagatccttggagatttctcagtcttatact
actacacaaagagaatctgatgattatagtgtaccttgcaaaagaaggaaaatagaagta
ggctgggaagtaataaaagattatcttcagaaatcacagaatgattttgatcttgtgcct
tggctgcagattacaacccagttaatatcaaagtatcctgcaagtttacctaactgtgag
ctgtgtccattactgatgatactataccagcttttacctcaacagcgacgtggagaacgg
acaccatacgtgttacgatgccttacagaaattgcgctgtgccaaagcaagaaatcaaac
ctggaaagctctcaaaaatcagatttatcgaaactctggattaaaatttggtctgttaca
ttttgtggtataaattctgtacaaatccaaactgaaaactttggcttgcttggggccatt
attcaaggtagcttagttgaggttgacagagaattctggaagttatttattggatcagcc
tgtaaaccttcaagtcctgcagtatgctgtttgactttggcactgaccatctgtgtaatt
ccagaagtattaaaaacaagaacagagcaaaatgtatatgaagtaaacagaagtttttct
ttaaaggagtcaataataagatggctcttactccgtcagtcagaggatgacttggacagt
aaagaccttcccccagttcttcagagtaattttcctcatctcatattagagaaaattctt
gtgagtctcactatgaaaaactgtaaagctgcaatgaattttttccagtgtgtgccagaa
tgtgaacaccaccaaaaagataaagaagagctttcattctcagaagttgaagaactattt
cttcagacaacttttgacaagatggattttttaagcattttgaaagaatgtgctgtagaa
aagtatcaatccagtattggcttttctgtccaccaaaatctcaaggaatcattgaatcac
tatcttctgggattatcagaacaacttctaaacaattcatctgagattacaaattcagaa
acccttgtccagtgttccattcttttggtgggtgttcttggctgctattgttatgtgggt
ataataactgaagaggaagcatataaatcagaattattccagaaagcaaagtctttaatg
cagtgtgcaggagaaagtatctctctgtttaaaaataagacaaatgaggaacctagaatt
ggttcattgagaattatgatgtgtctgtctacaagttgcttgtgtaactgtagcaagcag
aatccaaataagattacatctggctttttcctacgattgttaacatcaaagctgatgaat
gacattgcagatatttgtaaaagtttagcatcctttatcaaaaagccatttgactatggg
gaagtaaaatcagtggaagatgatactattgaaaatcgaaatgatgtgaattattcatca
tctacaaatctattccatgattacccttctagtagtagtgcaaatgatgcagatgatcct
gcagagaaccaaagtaccattggtgctatgaatcctttagcagaagagtatctgtcaaag
caagatctacttcttttagacatgctcaagttcttgtgtatgtgtgtgactgcatctcag
actaagtctgtgtcatttagagctgctgatattcggagaagattgttaatgctcattgat
tccagcacactagatcttactaaatccctccacttacacatgtacttagtgcttttaaag
gagctacctggagaacagtatcctttgccaatggaagatgttgttgaacttctgaaacca
ctgtccaatttgtgttctttgtatcgccgtgaccaagatgtttgtaaaacaattttaaag
catgtccttcatatagtgacaaacctaggtcaagacagtgtagatacagagaatacaaaa
gaggctcaaggacagttccttacggtgattggagcattttggcatctaacaaaggagaag
aaatgcacattctctgtaagaatggcaatagtaagatgccttaaaactctgcttgaggct
gatccttgttcaaaatgggctattcttaatgtaatggggaaaggctttcctgtaaatgaa
gtatttccacaatttctttctgatgataatcaccaagtgcgcatgttaaccgcagaatca
attaatagattattccaggatatgaaacaaggagattcttccatgttgttgaaatcactt
cctttgaagcttcaaaaaacagcttttgaaaatgcatacttgaaagcttgggaaggaatg
aaagaagtgtcgcatgatgctgagaatcctgaactttcagatgagacttataatagaaaa
tctgttttcctgatgatgatagctgtggttttatactgtagccctatttgtgaaaaacaa
gccttgtttgccttatgcaagtctgtgaaagagaatggattagattctcatcttgtgaaa
aaggttttaaagaaagtttctgaaacttttggatatagacatttagaagacttcatggct
tctcatttagattacctggtttcagaatggctaaatcttcaagattctgcatacagctta
tcttcttttccttttattttattaaactgctccaatgtggaggatttttataaatcttat
cataatgttttgattccacatttggtgattagaagttattttgatgaagtgaaggctatt
gctaatcagattcaagaggattggaaaaggcttctaataggctgctttccaaagattctt
gtaaatattcttccttattttgcatatgagggtactggagatgggatggcacaacaaaga
gagactgctaccaaggtctatgatatgcttaaaggtgaaaacctattgggaaaacagatt
gatcatttattcattagtaatttaccagagattgtggtggagttattgatgacattacat
gaaccagcagattttggtgccagccaaagcactgacctctgtaacttttctggggatttg
gatcctgctcctaatccaccctattttccatcacatgttattaaagcaacatttgcctat
atcagcaattgccataaaaccaagcgtaaaagcattttagaaattctttccaaaagccct
gattcctatccgaaaattcttttagccatttgtgagcaagcagctgagacaaataatgtt
tataagaagcacagaattcttaaaatatatcatctgtttgttagtttattactaaaggat
ataaaaagtggtttgggaggagcttgggcctttgttcttcgagatgttatttatacttta
attcaccatattaaccaaaggacttcccgtctcatggatgtgtcattacgtagcttctcc
ctttgttgtgacctattaagtcgggtttgccagacagcagtgactcactgcaaggatgct
ttagaaaaccatcttcatgttattgttggcacacttataccccttgtaaacgatcaggtg
aaagttcaaaagcaggtattggacttactgaaatacttagtgatagataacaaggataat
gaaaacctctatctcacaattaagcttttagatccgtttcctgaccatgctatttttaag
gatttgcgtattactcagcagaaaatcaaatacagtagaggatccttttcactcttggag
gaaattaaccattttctctcagttagtgtgtatgatgcacttccattgacaaggcttgaa
ggattgaaggatcttcgaagacaactggaacaacataaagatcagatgatgaatcttatg
agagcatctcaggataatccacaagatggcattgtggtaaagctagttgtcagcttgttg
cagttatcaaagatggcagtaaaccacactggtgaaaaagaagttttagaagctgttgca
agctgcttgggagaagtaggtcctatagatttctctaccatagctatacaacataataaa
gatacatcttataccaagagcctagagttatttgaagataaagaacttcagtggacttta
ataatcctgacctatctgaataacacattggtagaagatggtgtcaaagttcgatcagct
gctgttacctgtttgaaaaatattttagccacaaagactggacataatttctgggagatt
tataagatgacaactgatcccatgctgacctatctacagccttttagaacatcaagaaaa
aagtttttagaagtttccagacttgacaaagaaagccctttagaagacttgggtgataat
aatctgtggattcctcagagtgaaaatcatgatatttggataaagaccctgacttgtgct
attttggatagtggaggcgtgaaaagtgaaatccttcagttattaaagccaatgtgtcaa
gtgaaaactggcttttgtcagactgtgcttccatacttgattcatgatattttactccaa
gatataaatgaatcatggaaaaatctgctttctacacatgttcaaggatttttcaccaac
tgtttcagacacttgtcacaaacaagccgatccacaacccctgcgaatttggattcagag
tcagagctcttttcccagtgctgtttggataaaaaatcacaaagaacaatgcttgctgtt
gtagactatctgagaagacaaaagagaccttcatcagaaacagtttttgaagatgctttc
tggatggatttgaattatctggaggttgccaaggtagctcagtcttgtgctgcacacttt
acagccttgctctatgcagaaatctatgcagataagaaaagcatagatgaccaagagaaa
agaagtcttacatttgaagaaggaagccaaagtacaagtatttctagtttgagtgaaaaa
agtaaagaagaaactggaataagtttacaggatcttctcttagaaatctatagaagtata
ggagaaccagacagtctatatggctgtggtggagggaaaatgttacaaccccttactaga
ctacgaacatatgaacatgaagcgatgtgggagaaagccttagtaacatatgaccttgag
acagcaatttcctcatcaacccgccaggcaggaataattcaggctttgcagaatttggga
ctctgccatattctttccgtctacttaaagggattagacaatgaaaataaagagtggtgt
gctgaactacaggaacttcactaccaaactgcatggaggaatatgcagtgggaccattgc
atttctgtcaataaaggaatagaaggatctggttaccatgaatcattgtacaatgctctg
cagtctctaagagacagagaattctccacattttttgagtgcctcagatatgccagagtg
aaagaagtagaagagttgtgtaagggcagccttgaatctgtgtattcactgtaccccgca
cttagtagattgcaggccattggagagctggaaaacattggggagcttttcttgagatca
gtcacagatacacaactctctgaagtatatgtgaagtggcagaaacactcccagcttctt
aaggacagtgattttagttttcaggagcctatcatggctctacgtacaatcattttggag
atcctaatggaaaagaaaatggagaactcccaaagagaatgttttaaggacattcttacc
agacaccttgtagaattctctattctggcccgaactttcaagaacactcagctccctgaa
agggcactgtttcaaattaaacagtataattcaactgtttgtggaatctctgaatggcag
ctggaggaagcacaagtattctgggcaaaaaaagaacagagtcttgccctgagtattctc
aagcaaatgatcaagaagttggatgccagctttacagagagtaatccaaaccttaaactt
atgtacacagaatgtctgagggtttgtggcacctggttagcagaaacatgcttagaaaat
cctgcagtcatcatgcagacctatctagaaaaggcagtgcaaattgctgaaagttacaat
ggagaaagcaatgataagctcagaaatggaaaaatgaaggcatttctttcattagcaagg
ttctctgatactcagtaccagagaattgaaaattacatgaaatcatcagaatttgaaaac
aagcaagctctcttgaaaagggctaaagaggaagtgggcctcctaagggaacataaaatt
cagaccaacagatacacagtaaaggttcaaagagagctggagctggatgaatgtgcactc
catgcactgaaagaggatcgtaaacgcttcctgtgtaaagctgttgaaaattacatcaac
tgcttattaagtggagaagaacatgatatgtgggtattccgactttgttccctctggctt
gaaaattctggagtttttgaagttaatgccatgatgaagagagatggaatgaagatttca
tcatataagtttttacctcttatgtaccaactggctgctagaatggggaccaaaacgatg
ggagatctaggatttcatgaagtcctcaataatctcatctctagaattacaatggatcac
ccccatcatactttatttattatcttggctttagcaaatgcaaacaaagatgaatttctg
accaaaccagaggcagcaagaaggagtagaataactaaaaatgcacctaaacaaaactct
cagcttgacgaggatcggatggaagctgcaaatagaataatatgtactatcagaagtaag
agacctcagatggtcaagaatgttgaggcactttgtgatgcttatattatattagcaaat
ttagatgccactccatggaagacacagagaaaaggcatcaatattccagcagaccagcca
attaataaacttaagaatttagaggatgttgttgttcctactatggaaattaaggtggac
cccacaggagaatatggaaatctggtgacaatacagtcatttaaaacagaatttcgttta
gcaggaggtttaaatttaccaaaaataatagattgcataggctctgatggtaaggaaagg
agacagcttgtcaagggccgtgatgacttgagacaagatgctgtcatgcagcaagtattc
caaatgtgtaatacactactgcagagaaacagtgaaactagaaagaggaaactgactatc
tgcacatataaggtggtccccctctctcagcgaagtggtgttcttaaatggtgcacagga
actgtcccaattggtgaatttcttgttaacaatgaaggtggcgctcataaaagatacagg
ccaatggatttcagtgcctttcaatgccaaaagaaaatgatggatgtacagaagaagtcc
tttgaagagaaatatgaaactttcatggatatttgccaaaattttcaaccagttttccgt
tacttctgcatggaaaaattcctggaccctgctgtttggtttgagaaacgattggcttat
actcgcagtgtggccacttcttctattgtcggttacatccttggccttggtgatagacat
gtacagaacatattgataaatgaacagtcggcagaacttgttcatatagatttaggggtt
gcttttgaacagggtaaaatccttcctactcctgaaacagtcccttttagactcaccagg
gatattgtggatggtatgggcatcactggtgttgaaggtgtcttcagaagatgctgtgag
aaaactatggaagttatgagaaattctcaggaaactctgttaaccattgtagaggtcctc
ttgtatgatccactctttgactggaccatgaatcctttgaaagctttgtatttacagcag
aggcctgaagatgaaaatgagctccactccactcccagtgcagatgaccagcaatgcaaa
cgaaatcttagtgatactgaccagagtttgaacaaagtagctgaacgtgtcttgatgaga
ttgcaagaaaaactgaaaggagtggaggaaggcaccatgctcagtgtgggtggacaggtg
aatttgctcatacagcaggccatggatcccaaaaatctcagccgactcttcccaggatgg
aaagcttgggtgtga

DBGET integrated database retrieval system